DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and Cyp2d40

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_076112.2 Gene:Cyp2d40 MGIID:1919004 Length:338 Species:Mus musculus

Alignment Length:348 Identity:103/349 (30%)
Similarity:163/349 (47%) Gaps:43/349 (12%)


  Fly   180 DLTSVYVLNTLWCMLSG---------RRYEPGS---PEITQLLETF-----FELFKNIDMVGALF 227
            ||..|.:...::.:|..         .||.||.   |.:..||:..     :..:|.:.|     
Mouse     8 DLWPVAIFTVIFILLVDLLHRRQRWTSRYPPGPVPWPVLGNLLQVDLDNMPYSFYKVVKM----- 67

  Fly   228 SHFPLLRFIAPN-----FSGYNGFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQD- 286
              ||::..| |.     |.|...|:       |.:.|.:..|:.|:.....||||.|:::...: 
Mouse    68 --FPIVLRI-PGLADKIFPGQKTFL-------TMVDKLVTEHKRTWDPDQPPRDLTDAFMAEMET 122

  Fly   287 -EGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIP 350
             :||.|.. |::.:|..:.||:|..|..||:.:|.:..:.::|.|::|.|..:||.||:|..|.|
Mouse   123 AKGNPESS-FNEANLRLVVLDLFGGGIVTTSATLTWALLLMILHPDVQRRVQEEIDEVIGQARRP 186

  Fly   351 EWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDF 415
            |.: |:.::||..|:..|..|...:....:|||..||..:.|:.|||.|.:|.....:|.:...:
Mouse   187 EMA-DQARMPYTNAVIHEVQRFADIAPMTLPHRTSCDIEVQGFLIPKGTTLICNLSSVLKDETVW 250

  Fly   416 PDPESFNPDRYL-FDGHLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQ-V 478
            ..|..|.|:.:| ..||...||||.||..||..|:|:.|.|..||:|.|.:||.|......|| :
Mouse   251 EKPLRFYPEHFLDAQGHFVKPEAFMPFSAGRRACLGEPLVRMELFLFFTCLLQRFSFSVPDGQPL 315

  Fly   479 PEEVPLEGATAAVKPYDIMLVAR 501
            |.:..:.....:..||.:..|.|
Mouse   316 PSDYGIYSMVVSPAPYQLCAVVR 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 99/326 (30%)
Cyp2d40NP_076112.2 p450 <54..334 CDD:278495 90/297 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112116961
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.890

Return to query results.
Submit another query.