DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and Cyp2c66

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001011707.1 Gene:Cyp2c66 MGIID:1917138 Length:490 Species:Mus musculus

Alignment Length:496 Identity:144/497 (29%)
Similarity:239/497 (48%) Gaps:68/497 (14%)


  Fly     5 VIWIF------CATLLAILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQ 63
            |:.:|      |..||: |:....:.:..||||...||:|:.||:.         .|.|....|.
Mouse     2 VLGVFLGLLLTCLLLLS-LWKQNSQRRNLPPGPTPLPIIGNILQLD---------LKDISKSLRN 56

  Fly    64 YVNPYG-FYGLKIGKDKVVIAYTNDAISEMMTN--EDIDGRPDGIFYRLRTFNSRLGVLLTDGEM 125
            :...|| .:.|.:||...|:.:...|:.|.:.:  |:..||  |.|.....|..|.||:.:.|..
Mouse    57 FSKVYGPVFTLYLGKKPAVVLHGYKAVKEALIDHGEEFAGR--GTFPVADKFIRRCGVVFSSGRT 119

  Fly   126 WVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVL--- 187
            |.|.|||.|..|:|||..:..:.|.|..||.||:.:|         ::|:....|.|  ::|   
Mouse   120 WKEMRRFSLMTLRNFGMGKRSIEDRVQEEARCLVDEL---------RKTKGVPCDPT--FILGCA 173

  Fly   188 --NTLWCMLSGRRYEPGSPEITQLLETFFELF-KNIDMVGA----LFSHFPLLRFIAPNFSGYNG 245
              |.:..::...|::....|..    ||.::. :|::::.:    :.::||.:....|.      
Mouse   174 PCNVICSIVFQNRFDYKDQEFL----TFIDILNENVEILSSPWIQVCNNFPAIIDYLPG------ 228

  Fly   246 FVESHRSL--------YTFMSKEIELHRLTYKNYDEPRDLMDSYL-RAQDEGNDEKGMFSDQSLL 301
               .||.|        :.|::|.|: |:.:. :.:.|||.:|.:| :.:.|.::.|..|:.::|:
Mouse   229 ---RHRKLLKNFDFAKHYFLAKVIQ-HKESL-DINNPRDFIDCFLIKMEQEKHNPKTEFTCENLI 288

  Fly   302 AICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAIT 366
            ....|:|.||:|||:.:|.:..:.|:..||:..:...||..|:|..|.| ..:||..:||.:|:.
Mouse   289 FTASDLFAAGTETTSTTLRYSLLLLLKYPEVTAKVQAEIDCVIGRHRSP-CMQDRHSMPYTDAVL 352

  Fly   367 LEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFD-G 430
            .|..|...|....:||....|.:...|.|||.|.|||....:|.:..:|.:||.|:|..:|.: |
Mouse   353 HEIQRYIDLLPTSLPHAVTRDVKFREYLIPKGTTVIASLTSVLYDDKEFLNPERFDPSHFLDESG 417

  Fly   431 HLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKM 471
            ..|..:.|.||..|:..|:|:.|.|..||:|.||:||||.:
Mouse   418 KFKKSDYFFPFSTGKRICVGEGLARTELFLFLTTILQNFNL 458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 138/468 (29%)
Cyp2c66NP_001011707.1 p450 30..487 CDD:278495 138/468 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113197912
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.