DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and cyp2k19

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001073172.1 Gene:cyp2k19 ZFINID:ZDB-GENE-091211-1 Length:502 Species:Danio rerio

Alignment Length:515 Identity:146/516 (28%)
Similarity:245/516 (47%) Gaps:53/516 (10%)


  Fly    12 TLLAILF---------GGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVF---ARQY 64
            ||||.|.         .|.:|..:.||||...|::|:.|.:...|        ..|.|   ::.|
Zfish    15 TLLAALLLFLVLYLVSSGSQKEGKEPPGPKPLPLLGNLLTLDLTR--------AFDTFFELSKTY 71

  Fly    65 VNPYGFYGLKIGKDKVVIAYTNDAISEMMTN--EDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWV 127
            .|.:..:   :|..|.|:......:.|.:.|  |....|..|..:|:  .|...|:|.::||.|.
Zfish    72 GNVFQVF---LGPRKTVVLVGYKTVKEALVNYAEQFGDREIGPGFRI--MNDEHGILFSNGENWK 131

  Fly   128 EQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLT---SVYVLNT 189
            |.|||.|.:|::||..:.|..:.:..|    :..||.:..|..||.     .|.|   :..|.|.
Zfish   132 EMRRFALSNLRDFGMGKRGSEEKIIEE----IHHLKGEFDKFEGKP-----FDTTQPVNYAVSNI 187

  Fly   190 LWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHF-PLLRFIAPNFSGYNGFVESHRSL 253
            :..::.|.|:|...|:.|::::...|   |:.:.|::...| .:..::.|........||:....
Zfish   188 ISSIVYGSRFEYTDPQFTEMVDRANE---NVRVGGSVSMWFHEMFPWVGPFLKSKRIIVENIIQS 249

  Fly   254 YTFMSKEIELHRLTYKNYDEPRDLMDSYL--RAQDEGNDEK-GMFSDQSLLAICLDMFLAGSETT 315
            ...|:|.|.. .|...|.::||..:||:|  :..||.:.:| ..|.:::|:....::|:||::||
Zfish   250 RAQMTKLITA-LLETLNPNDPRGFVDSFLTRKLSDEKSGKKDSYFHEENLIMTVTNLFVAGTDTT 313

  Fly   316 NKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGI 380
            ..:|.:..|.:...|:||:|..:||..|:| .|.|. ..||.||||.:|:..|..|:..:....:
Zfish   314 GTTLRWGLMLMAKYPQIQDRVQEEIDRVIG-GRQPV-VEDRKKLPYTDAVIHEIQRLANIVPLSL 376

  Fly   381 PHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFD-GHLKLPEAFNPFGFG 444
            ||:...|...:||.|.|.|.|:.....:|.:..::..|.||.|:.:|.: |.....:||.||..|
Zfish   377 PHKTTSDITFNGYFIKKGTTVVPLLTSVLKDESEWEKPNSFYPEHFLDEKGQFVKRDAFIPFSAG 441

  Fly   445 RHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLE---GATAAVKPYDIMLVAR 501
            |..|:|:.|.|..||:|.|::||:::....||...:|:.|:   |.|....|:.:..:.|
Zfish   442 RRVCLGESLARMELFLFFTSLLQSYRFTTPPGVSEDELDLKGIVGITLNPSPHKLCAIRR 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 133/465 (29%)
cyp2k19NP_001073172.1 p450 61..497 CDD:278495 130/456 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.