| Sequence 1: | NP_001285977.1 | Gene: | Cyp303a1 / 49165 | FlyBaseID: | FBgn0001992 | Length: | 503 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001124095.1 | Gene: | cyp2k8 / 561462 | ZFINID: | ZDB-GENE-080721-19 | Length: | 507 | Species: | Danio rerio | 
| Alignment Length: | 501 | Identity: | 137/501 - (27%) | 
|---|---|---|---|
| Similarity: | 236/501 - (47%) | Gaps: | 62/501 - (12%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    28 PPGPAWYPIVGS--ALQVSQLRCRLGMFCKVIDVFARQYVNPYG-FYGLKIGKDKVVIAYTNDAI 89 
  Fly    90 SEMMTNEDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNE 154 
  Fly   155 ATCLLQDLKDKVLKSGGKQTRIEMHDLT---SVYVLNTLWCMLSGRRYEPGSPEITQLLETFFEL 216 
  Fly   217 FKNIDMVG-ALFSHFPLLRFIAPNFSGYNGFVESHRSLYTFMSKEIELHRLTYK----------N 270 
  Fly   271 YDEPRDLMDSYL-RAQD--EGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEI 332 
  Fly   333 QERAFQEIKEVV-GLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIP 396 
  Fly   397 KDTMVIACFRGMLINPVDFPDPESFNPDRYLFD-GHLKLPEAFNPFGFGRHRCMGDLLGRQNLFM 460 
  Fly   461 FTTTVLQNFKMVAIPGQVPEEV---PLEGATAAVKPYDIMLVAREQ 503 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Cyp303a1 | NP_001285977.1 | p450 | 28..480 | CDD:278495 | 130/473 (27%) | 
| cyp2k8 | NP_001124095.1 | p450 | 58..497 | CDD:278495 | 128/475 (27%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG45226 | |
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000008 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_100036 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X6 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.910 | |||||