DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and cyp2k8

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001124095.1 Gene:cyp2k8 ZFINID:ZDB-GENE-080721-19 Length:507 Species:Danio rerio

Alignment Length:501 Identity:137/502 (27%)
Similarity:236/502 (47%) Gaps:62/502 (12%)


  Fly    28 PPGPAWYPIVGS--ALQVSQLRCRLGMFCKVIDVFARQYVNPYG-FYGLKIGKDKVVIAYTNDAI 89
            ||||...|::|:  .|.:..|...|....|           .|| .:.:.:|:.|||:......:
Zfish    40 PPGPKPLPLLGNLHTLDLKNLHVSLWELSK-----------KYGPVFKVHLGRKKVVVLAGYKTV 93

  Fly    90 SEMMTNEDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNE 154
            .:.:.|:..:.....|....:..|...|::..:||.|...|||.|..|::||..:....:.:.:|
Zfish    94 KQALVNQAEEFGERDITPIFQDCNQGQGIVFANGERWRTMRRFALSTLRDFGMGKKLSEEKIVDE 158

  Fly   155 ATCLLQDLKDKVLKSGGKQTRIEMHDLT---SVYVLNTLWCMLSGRRYEPGSPEITQLLETFFEL 216
            .    :.|::..:|..|     :..|.|   :..|.|.:..::.|:|:|...|....::.   :.
Zfish   159 T----RYLREVFMKFEG-----QPFDTTQPVNYAVSNIISAIVYGKRFEYEDPAFQDMVN---KA 211

  Fly   217 FKNIDMVG-ALFSHFPLLRFIAPNFSGYNGFVESHRSLYTFMSKEIELHRLTYK----------N 270
            ..||.|:| |:...:.:..|:.|       ::::.|.|    .|.:|..|...:          |
Zfish   212 NMNIRMIGSAVIQIYNMCPFLGP-------WIKTWRQL----MKNMESTRRQIQTLADVLQETLN 265

  Fly   271 YDEPRDLMDSYL-RAQD--EGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEI 332
            ..:.|.|:||:| |.|:  |..::...|:||:||....::|.||::||..:|.:..|.:...|:|
Zfish   266 PLDCRGLIDSFLIRKQNIQETGEKDSSFNDQNLLITVSNLFAAGTDTTGTTLRWGLMLMAKYPQI 330

  Fly   333 QERAFQEIKEVV-GLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIP 396
            |:|..:||.:|: |.|.:.|   ||..|||.:|:..|..|:..:....:||:..||...:||.|.
Zfish   331 QDRVQEEIDQVLGGREPVAE---DRKNLPYTDAVIHETQRLANILPLNLPHKTSCDVTFNGYFIK 392

  Fly   397 KDTMVIACFRGMLINPVDFPDPESFNPDRYLFD-GHLKLPEAFNPFGFGRHRCMGDLLGRQNLFM 460
            |.|.|:.....:|.:..::..|::|||..:|.: |.|...:||.||..||..|:|:.|.|..||:
Zfish   393 KGTCVLPLLTSVLRDETEWETPDTFNPQHFLDEKGQLIKRDAFMPFSAGRRACLGESLARMELFL 457

  Fly   461 FTTTVLQNFKMVAIPGQVPEEV---PLEGATAAVKPYDIMLVAREQ 503
            |.|::||.|:....||...:|:   |:.|.|....|:.:..|.|.:
Zfish   458 FFTSLLQYFRFSPPPGASEDELDLTPVVGLTLNPSPHKLCAVIRAE 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 130/474 (27%)
cyp2k8NP_001124095.1 p450 58..497 CDD:278495 128/476 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.