DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and Cyp2c67

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001019890.1 Gene:Cyp2c67 MGIID:3612288 Length:491 Species:Mus musculus

Alignment Length:476 Identity:125/477 (26%)
Similarity:220/477 (46%) Gaps:31/477 (6%)


  Fly     5 VIWIFCATLLAILFGGVRKPKR--FPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNP 67
            |:.:.|.:.|.:|....::..|  .||||...||:|:...:..         |.|......:...
Mouse     5 VVLVLCLSFLLVLSLWRQRSARGNLPPGPTPLPIIGNYHLIDM---------KDIGQCLTNFSKT 60

  Fly    68 YG-FYGLKIGKDKVVIAYTNDAISEMMTN--EDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQ 129
            || .:.|..|...:|:.:..:|:.|...:  |:..||  |.|..........|:..:.|.:|...
Mouse    61 YGPVFTLYFGSQPIVVLHGYEAMKEAFIDHGEEFSGR--GRFPFFDKVTKGKGIGFSHGNVWKAT 123

  Fly   130 RRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCML 194
            |.|.:..|:|.|..:..:.:.|..||..|:::||    |:.|  ...:...:......|.:..::
Mouse   124 RVFTINTLRNLGMGKRTIENKVQEEAQWLMKELK----KTNG--LPCDPQFIIGCAPCNVICSIV 182

  Fly   195 SGRRYEPGSPEITQLLETFFELFKNIDMVGA-LFSHFPLLRFIAPNFSGYNGFVESHRSLYTFMS 258
            ...|::....:...|:....|..:.:...|. :|:..|:|....|  ..:|.|.::|..:.:::.
Mouse   183 FQNRFDYKDKDFLSLIGKVNECTEILSSPGCQIFNAVPILIDYCP--GRHNKFFKNHTWIKSYLL 245

  Fly   259 KEIELHRLTYKNYDEPRDLMDSYL--RAQDEGNDEKGMFSDQSLLAICLDMFLAGSETTNKSLGF 321
            ::|:.|..:. :...|||.:|.:|  |.|::| .|...::.:.|..:..|:...|:|:.:.::.|
Mouse   246 EKIKEHEESL-DVTNPRDFIDYFLIQRCQEKG-IEHMEYTIEHLATLVTDLVFGGTESLSSTMRF 308

  Fly   322 CFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVC 386
            ..:.|:....|..:..:||..|:|..|.| ..:||..:||..|:..|..|...|....:.|...|
Mouse   309 ALLLLMKHTHITAKVQEEIDNVIGRHRSP-CMQDRNHMPYTNAMVHEVQRYVDLGPISLVHEVTC 372

  Fly   387 DTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFD-GHLKLPEAFNPFGFGRHRCMG 450
            ||:...|.|||.|.|:.....:|.:..:||:||.|:|..:|.| |:.|..:.|.||..|:..|:|
Mouse   373 DTKFRNYFIPKGTQVMTSLTSVLHDSTEFPNPEVFDPGHFLDDNGNFKKSDYFVPFSAGKRICVG 437

  Fly   451 DLLGRQNLFMFTTTVLQNFKM 471
            :.|.|..||:|.||:|||||:
Mouse   438 ESLARMELFLFLTTILQNFKL 458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 120/452 (27%)
Cyp2c67NP_001019890.1 p450 30..487 CDD:278495 120/452 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111194185
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.