DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and cyp2aa8

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_021325465.1 Gene:cyp2aa8 ZFINID:ZDB-GENE-041010-183 Length:499 Species:Danio rerio

Alignment Length:478 Identity:136/479 (28%)
Similarity:232/479 (48%) Gaps:59/479 (12%)


  Fly    26 RFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYGF------YG----LKIGKDKV 80
            ||||||:..|.||:          |.:|.|          ||..|      ||    :.:|:...
Zfish    38 RFPPGPSPLPFVGN----------LPVFLK----------NPMEFIRSLSQYGEMTTIYLGRKPT 82

  Fly    81 VIAYTNDAISEMMTNEDIDGRPDGIFYRLRTFNSRLG-VLLTDGEMWVEQRRFILRHLKNFGFAR 144
            ::..|.....|::..:...|:|.  ...|...::.|| |::|....|.:||||.|..|:|||..|
Zfish    83 IMLNTVQLAKEVLIQDAFAGKPS--LPVLDWVSNGLGIVMVTFNHSWRQQRRFALHTLRNFGLGR 145

  Fly   145 SGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRYEPGSPEITQL 209
            ..:...|..|:..|:.:|    ||..||... ..|.|.:.: .|.:..::.|.|::.........
Zfish   146 KSVESRVLEESQYLIAEL----LKKKGKSVN-PHHALQNAF-SNVICSIVFGDRFDYDDKRFEHF 204

  Fly   210 LETFFELFKNIDMVGA----LFSHFPLLRFIAPNFSGYNGFVESHR-SLYTFMSKEIELHRLTYK 269
            ||.   |.|::.:.|:    :|:..|:::    :|.|.:..::.:. .|..|...|::.|:.|. 
Zfish   205 LEI---LGKSMILTGSTAGQIFNFAPIIK----HFPGPHQKIKKNADELSGFFQHEVKEHKKTL- 261

  Fly   270 NYDEPRDLMDSYLRAQDEGNDEK-GMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQ 333
            :...|||.:|:||...::....| ..|.|::|:....|:|:|||::|..:..:..:.|:..|::|
Zfish   262 DPGSPRDYIDAYLLEMEKQKSNKDSTFHDENLIGSTTDLFVAGSDSTATTFRWGLLFLIQNPDVQ 326

  Fly   334 ERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLSGYEIPKD 398
            ||..:||.:|:|.:|:|. ..||.:|||..|...|..|...|..||:.|..:..|:|.||::|:.
Zfish   327 ERCHKEIVQVLGYDRLPS-MEDRDRLPYTLATVHEIQRCANLAPFGLIHETIQPTKLQGYDLPRG 390

  Fly   399 TMVIACFRGMLINPVDFPDPESFNPDRYLFD-GHLKLPEAFNPFGFGRHRCMGDLLGRQNLFMFT 462
            |.:|.....:..|..::..|::|||:.:|.: |.....|:|.||..|...|:|:.|.|..||:|.
Zfish   391 TTIIVNLTAIFSNKENWKHPDTFNPENFLDESGQFSKHESFIPFSLGVRVCLGETLARTELFLFI 455

  Fly   463 TTVLQNFKMVAIPGQVPEEVPLE 485
            |.:||..:. ::|   |:..|::
Zfish   456 TALLQRIRF-SLP---PDAKPMD 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 133/470 (28%)
cyp2aa8XP_021325465.1 p450 40..491 CDD:306555 134/477 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.