DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and Cyp2c54

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_996260.1 Gene:Cyp2c54 MGIID:3642960 Length:490 Species:Mus musculus

Alignment Length:514 Identity:142/515 (28%)
Similarity:243/515 (47%) Gaps:66/515 (13%)


  Fly     5 VIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYG 69
            |:.:.|..||::......:.| .||||...||:|:.||:.     :...|:.....:|.|...|.
Mouse     8 VLTLSCLFLLSLWRQSYERGK-LPPGPTPLPIIGNILQID-----VKDICQSFTNLSRVYGPVYT 66

  Fly    70 FYGLKIGKDKVVIAYTNDAISEMMTNE-DI-DGRPDGIFYRLRTFN---SRLGVLLTDGEMWVEQ 129
            .|   :|:...|:.:..:|:.|.:.:. |: .||.     ||..|:   :.:|:..::|.:|...
Mouse    67 LY---LGRKPTVVLHGYEAVKEALVDHGDVFAGRG-----RLPVFDKATNGMGIGFSNGSVWKNT 123

  Fly   130 RRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVL-----NT 189
            |.|.|..|:|.|..:..:.|.|..||.||:::|:    |:.|...     |.|  ::|     |.
Mouse   124 RHFSLMTLRNLGMGKRSIEDRVQEEARCLVEELR----KTNGSPC-----DPT--FILGCAPCNV 177

  Fly   190 LWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVG-ALFSHFPLLRFIAPNFSGYNGFVESHRSL 253
            :..::...|::....:...|||...|:.|.:.... .:.:.||.|....|  ..:|.|.:::..:
Mouse   178 ICSIIFQDRFDYKDRDFLNLLEKLDEISKILSTPWLQVCNTFPALLDYCP--GSHNQFFKNYAYI 240

  Fly   254 YTFMSKEIELHRLTYKNYDE--PRDLMDSYLRAQDEGNDEKGMFSDQSLLAICL-DMFLAGSETT 315
            ..|:.::|..|:   ::.|.  |||.:|.:|....:.:|...:.::...|||.: |:|:.|:|:.
Mouse   241 KNFLLEKIREHK---ESLDVTIPRDFIDYFLIKGAQEDDNHPLKNNFEHLAITVTDLFIGGTESM 302

  Fly   316 NKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGI 380
            :.:|.:..:.|:..|.:..:..:||:.|:|..|.| ..:||:.:||..|:..|..|...|....:
Mouse   303 STTLRYALLLLLKYPHVTAKVQEEIEHVIGKHRRP-CMQDRSHMPYTNAMIHEVQRFIDLVPNNL 366

  Fly   381 PHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFD-GHLKLPEAFNPFGFG 444
            ||...||.:...|.|||.|.||.....:|.:..:||:||.|:|..:|.: |..|..:.|.||..|
Mouse   367 PHEVTCDIKFRNYFIPKGTTVITSLSSVLRDSKEFPNPEKFDPGHFLDENGKFKKSDYFMPFSTG 431

  Fly   445 RHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLEGATAAVKPYDI----MLV 499
            :..|.|:.|.|..||:|.|::||||.:          .||      |.|.||    ||:
Mouse   432 KRICAGEGLARMELFLFLTSILQNFNL----------KPL------VHPKDIDITPMLI 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 129/467 (28%)
Cyp2c54NP_996260.1 p450 30..487 CDD:278495 137/492 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111194153
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.