DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and Cyp305a1

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_649151.1 Gene:Cyp305a1 FlyBaseID:FBgn0036910 Length:504 Species:Drosophila melanogaster

Alignment Length:512 Identity:168/513 (33%)
Similarity:261/513 (51%) Gaps:36/513 (7%)


  Fly    10 CATLLAI----LFGGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYGF 70
            ||.|:..    |....|:||.|||||.:.|.:|:.||..:....:|....:.:.:|:.:.:  ..
  Fly     8 CAILIGFVIYSLISSARRPKNFPPGPRFVPWLGNTLQFRKEASAVGGQHILFERWAKDFRS--DL 70

  Fly    71 YGLKIGKDKVVIAYTNDAISEMMTNEDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRRFILR 135
            .|||:|::.||:|..::.:.|:...|..:||||..|.||||..:|.|:..|||::|.|.|.|.::
  Fly    71 VGLKLGREYVVVALGHEMVKEVQLQEVFEGRPDNFFLRLRTMGTRKGITCTDGQLWYEHRHFAMK 135

  Fly   136 HLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSV-----YVLNTLWCMLS 195
            .::|.|:.||.|...:..||..||           |:..|.|...:..|     .|||.|||:::
  Fly   136 QMRNVGYGRSQMEHHIELEAEELL-----------GQLERTEEQPIEPVTWLAQSVLNVLWCLIA 189

  Fly   196 GR---RYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFSGYNGFVESHRSLYTFM 257
            |:   |.|.|:  :.:||:......|..|:.|.|.:.||.||.:||:.:|||...:.:..||.|.
  Fly   190 GKRIARQEDGT--LRRLLDLMNRRSKLFDICGGLLAQFPWLRHVAPDRTGYNLIQQLNTELYGFF 252

  Fly   258 SKEIELHRLTYKNYDEP--RDLMDSYLRAQDE--GNDEKGMFSDQSLLAICLDMFLAGSETTNKS 318
            ...||.||........|  .||:.:||:...:  ...|...|::..|:...||.|:|||:||:.:
  Fly   253 MDTIEEHRRQLAKDPSPAESDLIYAYLQEMKDRSAGGESSTFNETQLVMTILDFFIAGSQTTSNT 317

  Fly   319 LGFCFMHLVLQPEIQERAFQEIKEVV---GLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGI 380
            :....|.|.::|::||:.|.::...|   ..:..|..|| |....|.:|..:|..|.|.:.....
  Fly   318 INLALMVLAMRPDVQEKLFSQVTASVAAASTDAFPHLSR-REAFDYMDAFIMEVQRFFHITPITG 381

  Fly   381 PHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFD-GHLKLPEAFNPFGFG 444
            |.||:..|:|.||:|||:..::...|.:.::...:.||..|.|:|::.. |.....|.|.|||.|
  Fly   382 PRRALWATKLGGYDIPKNATILISLRSVHLDKEHWKDPLEFRPERFIDSAGKCFKDEYFMPFGMG 446

  Fly   445 RHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLEGATAAVKPYDIMLVAR 501
            |.||:||.|.|..:|.|...::|:|.:|...|:.|..|.|.|.|...|||.:..|.|
  Fly   447 RRRCLGDALARACIFSFLVRIVQHFSVVLPAGESPSMVLLPGITLTPKPYKVQFVKR 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 151/468 (32%)
Cyp305a1NP_649151.1 p450 30..500 CDD:278495 158/486 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110278618
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
orthoMCL 1 0.900 OOG5_126582
Panther 1 1.100 P PTHR24303
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.