DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and cyp2p6

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_956433.1 Gene:cyp2p6 ZFINID:ZDB-GENE-040426-790 Length:496 Species:Danio rerio

Alignment Length:515 Identity:141/516 (27%)
Similarity:244/516 (47%) Gaps:51/516 (10%)


  Fly     5 VIWIFCATLLAILFGGVRKPKRFPPGPAWYPIVGSA---------LQVSQLRCRLGMFCKVIDVF 60
            |::..|..||...:...:.||.|||||...||:|:.         |:|.:|..:.|....| .:|
Zfish    15 VLFFACVFLLLSNYIRNKTPKNFPPGPWPLPIIGNLYHIDFNKIHLEVEKLSEKYGSVVSV-HLF 78

  Fly    61 ARQYVNPYGFYGLKIGKDKVVIAYTNDAISEMMTNEDIDGRPD-GIFYRLRTFNSRLGVLLTDGE 124
            .::.|...|:..:|    :|.|          ...:::..||: .:.:.:...|   |::...|.
Zfish    79 GQRTVILNGYKQVK----EVYI----------QQGDNVADRPELPMIHDIAGDN---GLVAPSGY 126

  Fly   125 MWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNT 189
            .|.:||||.|..|:|||..:..:...::.|.    ..|.:.:....|:.  .:.|.|.:..:.|.
Zfish   127 KWKQQRRFALSTLRNFGLGKKSLEPSINLEC----HYLNEAISNENGRP--FDPHLLLNNAISNV 185

  Fly   190 LWCMLSGRRYEPGSPEITQLLETFFE-LFKNIDMVGALFSHFPLLRFIAP-----NFSGYNGFVE 248
            :..::.|.|::........||....| ::.:..:...|::.:|.:..:.|     |.:.:|..::
Zfish   186 ICVLVFGNRFDYSDHHFQTLLNDINEAMYLDGTIWAQLYNSYPRIMRLLPGPHKKNITLWNKVID 250

  Fly   249 SHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFSDQSLLAIC-LDMFLAGS 312
                   |..:.::.||:.| :...|||.:|.:|...::..|:.....|...|.|| ||:|:||:
Zfish   251 -------FARERVKEHRVDY-DPSNPRDYVDCFLAEMEKLKDDTAAGFDVENLCICTLDLFVAGT 307

  Fly   313 ETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHT 377
            |||:.:|.:..::::..||||.:..:||..|:|..|.|..| ||..:||..|:..|..|...:..
Zfish   308 ETTSTTLSWSLLYMIKYPEIQAKVQEEIDRVIGSSRHPSVS-DRDNMPYTNAVIHEIQRFGNIAA 371

  Fly   378 FGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYL-FDGHLKLPEAFNPF 441
            ..:|..||.|.::..|.|||.|:||.....:|.:..::..|.||||..:| .:|..:..:||.||
Zfish   372 LNLPRAAVKDIQVGKYLIPKGTIVIGNLTSVLFDESEWETPHSFNPGHFLDAEGKFRRRDAFLPF 436

  Fly   442 GFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLEGATAAVKPYDIMLVAR 501
            ..|:..|:|:.|.|..||:|.|::||:|...:..|..|......|.|.|.||:.:..|:|
Zfish   437 SLGKRVCLGEQLARMELFLFFTSLLQHFTFSSPAGVEPSFNYKLGTTRAPKPFKLCAVSR 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 127/470 (27%)
cyp2p6NP_956433.1 p450 38..492 CDD:278495 132/487 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.