DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and cyp2aa3

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_938183.2 Gene:cyp2aa3 ZFINID:ZDB-GENE-031030-8 Length:496 Species:Danio rerio

Alignment Length:525 Identity:146/526 (28%)
Similarity:239/526 (45%) Gaps:77/526 (15%)


  Fly     8 IFCATLLAILFGGVR---KPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYG 69
            :|...::.:||...|   ..:|.||||...|.||:          :..|.|          ||.|
Zfish    17 LFLGLIILVLFEIFRIHSYKRRTPPGPTPLPFVGT----------IPHFLK----------NPLG 61

  Fly    70 F------YG----LKIGKDKVVIAYTNDAISEMMTNEDIDGRP---------DGIFYRLRTFNSR 115
            |      ||    :.:|:...:...|.....|.:..:...|:|         .|....:.|||  
Zfish    62 FIRSMSQYGDMSTMYLGRKPAIFLNTIQLAKETLVQDTFSGKPYLPVIEWISKGFGIAMVTFN-- 124

  Fly   116 LGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHD 180
                    ..|.:||||.|..|||||..:..:.|.|..|:..|:.::    ||..||.  ::.|.
Zfish   125 --------HSWRQQRRFALHTLKNFGLGKKSVEDRVLEESRYLIAEM----LKDEGKP--VDPHH 175

  Fly   181 LTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSH-FPLLRFIAPNFSGYN 244
            .....|.|.:..::.|.|:|..:.....||:.   |.:.|.:.|:.... |.|:.|| .:|.|.:
Zfish   176 PIQNAVSNIICSIVFGDRFEYNNKRFEYLLKM---LNETIMLAGSASGRIFNLVPFI-KHFPGPH 236

  Fly   245 GFVESHR-SLYTFMSKEIELHRLTYKNYDEPRDLMDSY-LRAQDEGNDEKGMFSDQSLLAICLDM 307
            ..::.:. .|..|:..|:|.||.|. :...|||.:|:| |..:.:..::...|.:.:|||...|:
Zfish   237 QKIKKNTDDLLIFLGDEVEEHRKTL-DPGSPRDFIDAYLLEIEKQKFNKDSTFHEGNLLASAGDL 300

  Fly   308 FLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRM 372
            |:||::||..::.:..:.|:..|::|||..:||.:|:|.:|:|... ||.:|||    ||..|..
Zfish   301 FMAGTDTTETTIRWGLLFLIQNPDVQERCHEEIVQVLGYDRLPSMD-DRDRLPY----TLATVHE 360

  Fly   373 FMLHTFGIP---HRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFDGHLKL 434
            ...:...||   |..:..|:|.||.||:.|.::...:.:..:...:..|:||||:.:|.|.|...
Zfish   361 IQRYGNIIPILIHETILPTKLQGYSIPQGTTIVTNIQAIFSSKDHWKHPDSFNPENFLEDRHFIK 425

  Fly   435 PEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLEGATAAV-KPYDIML 498
            ||:|..|..|...|:|::|.|..||:|.|::||.......|...|  :.::|....| .|....:
Zfish   426 PESFIMFSLGPRSCLGEILARTELFLFITSLLQRIHFSWPPDAKP--IDMDGIFGLVHSPQAFNV 488

  Fly   499 VAREQ 503
            :.|.:
Zfish   489 ICRSR 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 137/477 (29%)
cyp2aa3NP_938183.2 p450 40..480 CDD:278495 138/488 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.