DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and Cyp2b3

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_775416.1 Gene:Cyp2b3 RGDID:628627 Length:491 Species:Rattus norvegicus

Alignment Length:519 Identity:146/520 (28%)
Similarity:244/520 (47%) Gaps:51/520 (10%)


  Fly     4 TVIWIFCATLLAILF----GGVRKPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQY 64
            |.:.:..|.||:.|.    |..:.....||||...|::|:.||:.:     |.|.|.......::
  Rat     3 TSVLLLLAVLLSFLLFLVRGHAKVHGHLPPGPRPLPLLGNLLQMDR-----GGFRKSFIQLQEKH 62

  Fly    65 VNPYGFYGLKIGKDKVVIAYTNDAISEMMTN--EDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWV 127
            .:.:..|   .|...||:......|.|.:.:  |...||  ||...|:......||...:.|.|.
  Rat    63 GDVFTVY---FGPRPVVMLCGTQTIREALVDHAEAFSGR--GIIAVLQPIMQEYGVSFVNEERWK 122

  Fly   128 EQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWC 192
            ..||..:..:::||..:..:.|.:..||.||:::||:.      :...::...|......|.:..
  Rat   123 ILRRLFVATMRDFGIGKQSVEDQIKEEAKCLVEELKNH------QGVSLDPTFLFQCVTGNIICS 181

  Fly   193 MLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFSGYNGFVE----SHRSL 253
            ::.|.|::....:..:||:..:..|..|.            .|.:..|..|:.|::    .||.:
  Rat   182 IVFGERFDYRDRQFLRLLDLLYRTFSLIS------------SFSSQMFEVYSDFLKYFPGVHREI 234

  Fly   254 Y-------TFMSKEIELHRLTYKNYDEPRDLMDSY-LRAQDEGNDEKGMFSDQSLLAICLDMFLA 310
            |       .::...:|.||.|. :.:.|||.:|:: |..:.|..:....|...:|:...|.:|||
  Rat   235 YKNLKEVLDYIDHSVENHRATL-DPNAPRDFIDTFLLHMEKEKLNHYTEFHHWNLMISVLFLFLA 298

  Fly   311 GSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFML 375
            |:|:|:.:|.:.|:.::..|.:.|:..:||.:|:|.:|:|... ||:|:||.||:..|..|...:
  Rat   299 GTESTSNTLCYGFLLMLKYPHVAEKVQKEIDQVIGSQRVPTLD-DRSKMPYTEAVIHEIQRFSDV 362

  Fly   376 HTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYL-FDGHLKLPEAFN 439
            ...|:|.|...||...||.:||:|.|.......|.:|..|..|::|||:.:| .:|.||..|||.
  Rat   363 SPMGLPCRITKDTLFRGYLLPKNTEVYFILSSALHDPQYFEQPDTFNPEHFLDANGALKKCEAFM 427

  Fly   440 PFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVA-IPGQVPEEVPLEGATAAVKP-YDIMLVAR 501
            ||..|:..|:|:.:.|..||:|.||:|||:.:.: :.....:..|.|...|.|.| |.|..|||
  Rat   428 PFSIGKRMCLGEGIARSELFLFFTTILQNYSVSSPVDPNTIDMTPKESGLAKVAPVYKICFVAR 491

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 130/468 (28%)
Cyp2b3NP_775416.1 p450 42..488 CDD:278495 131/476 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111634457
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.