DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and cyp-33C11

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_503303.1 Gene:cyp-33C11 WormBaseID:WBGene00021710 Length:495 Species:Caenorhabditis elegans

Alignment Length:475 Identity:131/476 (28%)
Similarity:220/476 (46%) Gaps:62/476 (13%)


  Fly    23 KPKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYG-FYGLKIGKDKVVIAYTN 86
            |.:..||||...|.:|::|  |.:....|..|      .|::...|| .:...:|....|:..:.
 Worm    21 KRRNLPPGPTPLPFLGNSL--SMIWENPGYEC------FRRWTRIYGDVFTFWLGDTPYVVISSL 77

  Fly    87 DAISEMMTNEDIDGRPDGIFYRLR---TF-----NSRLGVLLTDGEMWVEQRRFILRHLKNFGFA 143
            :.:.|....       ||..|:.:   :|     ..|.||:.|.|.||...|||.:...::.|..
 Worm    78 EKMKETFIK-------DGETYQDKIQFSFTEKFRGGRFGVIETTGHMWSTHRRFAISTFRDLGLG 135

  Fly   144 RSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVY--VLNTLWCMLSGRRYEPGSPEI 206
            ::.|.:.:..|...:.|.|...:   |.:|...|:     :|  |.|.:..|:.|.|::..:   
 Worm   136 KNLMQEKILAEVEAVFQILDANL---GAEQDVPEV-----IYNAVANVINQMIFGYRFDESN--- 189

  Fly   207 TQLLETFFELFKN-IDMVGALFSHF--------PLLRFIAPNFSGYNGFVESHRSLYTFMSKEIE 262
                :..||..|: ||:....|:.|        |::..:.|..|..:...|.....|.|...:|:
 Worm   190 ----QNEFEKLKDLIDIQEKSFASFKLCVQAFVPIMNKLLPGKSLEDLIAEKRHDYYNFFYAQIQ 250

  Fly   263 LHRLTYKNY--DEPRDLMDSYLRAQDEGNDEKG-----MFSDQSLLAICLDMFLAGSETTNKSLG 320
            .||... ||  :|..|..::||:.|.  |.|:|     :||||.|..:|.|::.||..|||.::.
 Worm   251 DHRAKI-NYQAEEYLDYAEAYLKEQK--NQEQGGLGSDLFSDQQLANMCFDLWFAGLTTTNTTIN 312

  Fly   321 FCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAV 385
            :...:::..||:|::..:|:.:|||.:|:...| |::.|||..|:..|:.|...|....:.|...
 Worm   313 WTISYVLNHPEVQDKMQEELDKVVGSDRLVTIS-DKSSLPYMNAVINESQRCVNLLPCNLFHATT 376

  Fly   386 CDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYLFD-GHLKLPEAFNPFGFGRHRCM 449
            .||.::|..|||.|.|||....::::...||||..|.|:|::.: |.||..|...||..|:.:|:
 Worm   377 RDTVINGNIIPKGTGVIAQISTVMLDEKIFPDPYKFQPERFIDENGALKKIEQLIPFSVGKRQCL 441

  Fly   450 GDLLGRQNLFMFTTTVLQNF 469
            |:.|.|..||:....:...:
 Worm   442 GEGLARMELFLIVANLFNRY 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 130/471 (28%)
cyp-33C11NP_503303.1 p450 26..490 CDD:278495 130/471 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110264596
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.