DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and cyp-33E2

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_501470.2 Gene:cyp-33E2 WormBaseID:WBGene00018334 Length:494 Species:Caenorhabditis elegans

Alignment Length:502 Identity:139/503 (28%)
Similarity:241/503 (48%) Gaps:52/503 (10%)


  Fly    23 KPKRFPPGPAWYPIVGSALQVS-QLRCRLGMFCKVIDVFARQYVNPYGFYGLKIGKDKVVIAYTN 86
            |.:..||||...|:||:...:| .::....:|..:    ..||.:.|.|:     ...:.|.:..
 Worm    21 KRRNLPPGPLPLPLVGNLHMMSDDVKPGYSLFSNL----KEQYGHVYTFW-----MASLPIVHVT 76

  Fly    87 D--AISEMMTNE--DIDGRPD-GIFYRLRTFNSRLGVLLTDGEMWVEQRRFILRHLKNFGFARSG 146
            |  .|.:....:  :..|||: .:...||  ....|::.:.|:.||:||||.|..|::||..::.
 Worm    77 DWNLIKQHFIKDGGNFVGRPEFPMSIELR--QGPYGIIESHGDRWVQQRRFALHVLRDFGLGKNL 139

  Fly   147 MMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVY------VLNTLWCMLSGRRYEPGSPE 205
            |.:.|..|.|.:|..|         ::|..|: |:.||:      |:|.|   |.|.||:  ...
 Worm   140 MEEKVLGEVTAMLDRL---------RKTMDEV-DMQSVFDASVGSVINNL---LFGYRYD--ETN 189

  Fly   206 ITQLLETFFELFKNIDM----VGALFSHFPLLRFIAPNFSGY-NGFVESHRSLYTFMSKEI--EL 263
            |.:.|:...:|..:..:    :|.|....|.|.:. |.|||| |..:::...|.....|:.  :|
 Worm   190 IAEFLDLKEKLNNHFQLAAKPIGGLIGMNPWLGYF-PYFSGYKNVMIQNWMGLVEMFRKQANEKL 253

  Fly   264 HRLTYKNYDEPRDLMDSYLRAQDEGNDEK--GMFSDQSLLAICLDMFLAGSETTNKSLGFCFMHL 326
            ..:.|:: |:..|.::::|:.:.:..:||  |.|..:.|.::|.|:::||.|||:.:|.:..:::
 Worm   254 ATIDYES-DDYSDYVEAFLKERKKHENEKDFGGFEMEQLDSVCFDLWVAGMETTSNTLNWALLYV 317

  Fly   327 VLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMFMLHTFGIPHRAVCDTRLS 391
            :..||::::.::|:...:|.:||...| |:.||.|..|...|:.|:..|....:......|..::
 Worm   318 LRNPEVRQKVYEELDREIGSDRIITTS-DKPKLNYINATINESQRLANLLPMNLARSTTKDVEIA 381

  Fly   392 GYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYL-FDGHLKLPEAFNPFGFGRHRCMGDLLGR 455
            ||.|.|:|::|.....:|.||..||:|..|.|:|:| .||.||..|...||..|:.:|.|:.|.:
 Worm   382 GYHIKKNTVIIPQISLVLYNPEIFPEPYEFKPERFLESDGSLKKVEELVPFSIGKRQCPGEGLAK 446

  Fly   456 QNLFMFTTTVLQNFKMVAIPGQVPEEVPLE-GATAAVKPYDIMLVAR 501
            ..|.:|...:...|.:..........|..| |.|...|.|.:.|..|
 Worm   447 MELLLFFANLFNRFDIQLHQSNPNPSVEKEFGVTMKAKSYRLKLKDR 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 130/474 (27%)
cyp-33E2NP_501470.2 p450 35..490 CDD:278495 131/484 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110285003
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.