DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and cyp-33E1

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_501480.2 Gene:cyp-33E1 WormBaseID:WBGene00016768 Length:494 Species:Caenorhabditis elegans

Alignment Length:529 Identity:142/530 (27%)
Similarity:251/530 (47%) Gaps:69/530 (13%)


  Fly     5 VIWIFCATLLAILFGGVR-KPKRFPPGPAWYPIVGSA-LQVSQLRCRLGMFCKVIDVFARQYVNP 67
            ::.|..:.|:..||.... |.::.||||...||:|:. |....::....|:.|:.|    :|...
 Worm     2 ILLILTSILIIYLFNHFYWKRRKLPPGPIPLPIIGNLYLMTEDVKPGYKMYEKLKD----KYGPV 62

  Fly    68 YGFYGLKIGKDKVVIAYTNDAISEMMTNED---IDGRPD-GIFYRLRTFNSRLGVLLTDGEMWVE 128
            :.|:...:    .::..|:..:.:....:|   ..|||: .|...:|  ....|::.:.|:.|::
 Worm    63 FTFWLANL----PMVTVTDWKLIKQHFIKDGANFVGRPEFPISMEMR--QGPYGIIESHGDRWIQ 121

  Fly   129 QRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCM 193
            ||||.|..|::||..::.|.:.|..|.|.::    |.:.||   ...::|.::....|.:.:..|
 Worm   122 QRRFALHILRDFGLGKNLMEEKVLGEVTAMI----DSIRKS---MEDVDMQNIFDASVGSVINNM 179

  Fly   194 LSGRRYEPGSPEITQLLETFFELFKN---------IDMVGALFSHFPLLRFIAPNFSGYN----- 244
            |.|.||:..:      :|.|.|| ||         .:.:|.|....|.|..: |.|.||.     
 Worm   180 LFGYRYDETN------IEEFLEL-KNRMNKHFKLAAEPMGGLIGMNPWLGHL-PFFKGYKNVIMH 236

  Fly   245 ---GFVESHRSLYTFMSKEIELHRLTYKNY--DEPRDLMDSYL--RAQDEGNDEKGMFSDQSLLA 302
               |.:|..|...|        .||...:|  ||..|.::::|  |.:.|...:.|.|..:.|.:
 Worm   237 NWMGLMEMFRKQAT--------DRLASIDYDSDEYSDYVEAFLKERKKHENEQDFGGFEMEQLDS 293

  Fly   303 ICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITL 367
            :|.|:::||.|||:.:|.:..::::|.||::::.::|::..:|.:||.. :.||.||.|..|...
 Worm   294 VCFDLWVAGMETTSNTLNWALLYVLLNPEVRQKVYEELEREIGSDRIIT-TTDRPKLNYINATVN 357

  Fly   368 EAVRMFMLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYL-FDGH 431
            |:.|:..|....:......|..::||.|||||::......::.:|..||:|..|.|:|:| .||.
 Worm   358 ESQRLANLLPMNLSRSTNADVEIAGYRIPKDTVITPQISSVMYDPEIFPEPYEFKPERFLESDGS 422

  Fly   432 LKLPEAFNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKM---VAIPG-QVPEEVPLEGATAAVK 492
            ||..|...||..|:.:|:|:.|.:..||::...:...|.:   .:.|. .:.:||   |.|...|
 Worm   423 LKKVEELVPFSIGKRQCLGEGLAKMELFLYFANLFNKFDIKFHESNPNPSIKKEV---GVTMKAK 484

  Fly   493 PYDIMLVAR 501
            .|.:.:..|
 Worm   485 NYRVSMKER 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 130/483 (27%)
cyp-33E1NP_501480.2 p450 49..490 CDD:278495 128/478 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110285028
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.