DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyp303a1 and cyp2p8

Sequence 1:NP_001285977.1 Gene:Cyp303a1 FlyBaseID:FBgn0001992 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001076504.1 Gene:cyp2p8 ZFINID:ZDB-GENE-061030-1 Length:496 Species:Danio rerio

Alignment Length:519 Identity:145/520 (28%)
Similarity:244/520 (47%) Gaps:43/520 (8%)


  Fly     1 MFYTVIWIFCATLLA-----ILFGGVRK---PKRFPPGPAWYPIVGSALQVSQLRCRLGMFCKVI 57
            ::|...||...::|.     :|.|...|   ||.|||||...||:|....:...:..| .|.|  
Zfish     3 LWYLYEWIDIKSILIFLCVFLLLGDYIKNKAPKNFPPGPWSLPIIGDLHHIDNSKIHL-QFTK-- 64

  Fly    58 DVFARQYVNPYGFYGLKIGKDKVVIAYTNDAISE--MMTNEDIDGRPD-GIFYRLRTFNSRLGVL 119
              ||.:|.|.:.|   ::...::|:....:.:.|  :...:::..||. .:||.:   ....|::
Zfish    65 --FAERYGNIFSF---RLFGPRIVVLNGYNLVKEVYIKQGDNLADRPVLPLFYEI---VGDKGLI 121

  Fly   120 LTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGK--QTRIEMHDLT 182
            |:.|..|..||||.|..|:|||..:..:...::.|...    |.:.:....|:  ..|:.:::..
Zfish   122 LSSGYKWKHQRRFALSTLRNFGLGKKSLEPSINVECGF----LNEAISNEQGRPFDPRLLLNNAV 182

  Fly   183 SVYVLNTLWCMLSGRRYEPGSPEITQLLETFFE-LFKNIDMVGALFSHFPLL--RFIAPNFSGYN 244
            |    |.:..::.|.|::........||:...| ::....:...|::.||.|  |...|    :.
Zfish   183 S----NVICVLVFGNRFDYSDHHFQTLLKNISEAVYLEGSICNQLYNMFPWLMERLPGP----HK 239

  Fly   245 GFVESHRSLYTFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKGMFSDQSLLAIC-LDMF 308
            ..:...|.:..|:.:::..||:.| :...|||.:|.:|...::..|:.....|...|.|| ||:|
Zfish   240 TIITLWRKVTDFVREKVNEHRVDY-DPSNPRDYIDCFLTEMEKLKDDTAAGFDVENLCICSLDLF 303

  Fly   309 LAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLEAVRMF 373
            :||:|||:.:|.:..::::..||||.:..:||..|||..|.|..| ||..:||..|:..|..||.
Zfish   304 VAGTETTSTTLYWGLLYMIKYPEIQAKVQEEIDAVVGGSRQPSVS-DRDNMPYTNAVIHEIQRMG 367

  Fly   374 MLHTFGIPHRAVCDTRLSGYEIPKDTMVIACFRGMLINPVDFPDPESFNPDRYL-FDGHLKLPEA 437
            .:....:......||::..|.|||.|||.:....:|.:..::..|.||||..:| .:|..:..:|
Zfish   368 NIAPINLARSTSEDTQIGNYSIPKGTMVTSNLTSVLFDESEWETPHSFNPGHFLDAEGKFRRRDA 432

  Fly   438 FNPFGFGRHRCMGDLLGRQNLFMFTTTVLQNFKMVAIPGQVPEEVPLEGATAAVKPYDIMLVAR 501
            |.||..|:..|:|:.|.|..||:|.:::||.|......|..|......|.|...||:.:..|.|
Zfish   433 FLPFSLGKRVCLGEQLARMELFLFFSSLLQRFTFSPPAGVEPSLDYKMGGTHCPKPFKLCAVPR 496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyp303a1NP_001285977.1 p450 28..480 CDD:278495 129/462 (28%)
cyp2p8NP_001076504.1 p450 38..492 CDD:278495 133/479 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.