DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mbs and ppp1r27

Sequence 1:NP_001246786.1 Gene:Mbs FlyBaseID:FBgn0005536 Length:1273 Species:Drosophila melanogaster
Sequence 2:XP_002937360.1 Gene:ppp1r27 XenbaseID:XB-GENE-955186 Length:141 Species:Xenopus tropicalis

Alignment Length:114 Identity:46/115 (40%)
Similarity:70/115 (61%) Gaps:1/115 (1%)


  Fly    34 PRHEHGRRIKFSSGCVFLAACLSGDKDEVVQLL-DQGADINTANVDGLTALHQACIDDNLDMVEF 97
            |.|...|.::|.:..:||.....||.::|.:.: .:...::|..:.|:.|||:|.:..||:.|:.
 Frog     5 PSHRSARTVRFPNDILFLDHIRQGDLEQVGRFIRARKVTMDTIYLSGMAALHEAVLSGNLECVKL 69

  Fly    98 LVERGADINRQDNEGWTPLHATASCGFVSIARYLVENGADVAAVNSDGD 146
            ||:.||||:::|..||||||...|.|:..|||||:..||...||||||:
 Frog    70 LVKYGADIDQRDENGWTPLHMACSDGYPHIARYLLSLGAQSDAVNSDGE 118

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MbsNP_001246786.1 ANK 50..164 CDD:238125 42/99 (42%)
Ank_2 53..142 CDD:289560 36/90 (40%)
ANK repeat 78..109 CDD:293786 14/31 (45%)
ANK 106..290 CDD:238125 22/42 (52%)
ANK repeat 111..142 CDD:293786 17/31 (55%)
ANK repeat 209..239 CDD:293786
Ank_2 213..300 CDD:289560
ANK repeat 241..272 CDD:293786
PRKG1_interact 1177..1272 CDD:292521
ppp1r27XP_002937360.1 ANK 25..134 CDD:238125 40/95 (42%)
ANK repeat 54..81 CDD:293786 13/27 (48%)
Ank_2 55..141 CDD:289560 34/65 (52%)
ANK repeat 83..114 CDD:293786 17/31 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0505
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.