DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NT5E and NT5E-2

Sequence 1:NP_002517.1 Gene:NT5E HGNCID:8021 Length:574 Species:Homo sapiens
Sequence 2:NP_611218.1 Gene:NT5E-2 FlyBaseID:FBgn0050104 Length:585 Species:Drosophila melanogaster

Alignment Length:567 Identity:229/568 (40%)
Similarity:333/568 (59%) Gaps:47/568 (8%)


Human    26 AWELTILHTNDVHSRLEQTSEDSSKC----VNASRCMGGVARLFTKVQQIRR----AEPNVLLLD 82
            |.|..|||.||:|:|.:|||.:|..|    |:.::|.||.||:..:|::.|:    ...:||.|:
  Fly    30 ATEFIILHNNDMHARFDQTSVNSGTCPPEDVHTNKCYGGFARVAHEVRKYRKEAQEGGTSVLYLN 94

Human    83 AGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSAN---- 143
            |||.|.||.|||::|....:.|:|.|:.||::|||||||..||||| |.|.|..||:|:.|    
  Fly    95 AGDTYTGTSWFTIFKDKIASAFLNKLKPDAISLGNHEFDERVEGLI-PFLNEVTFPVLACNLDLS 158

Human   144 ----IKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEV 204
                :||...||:.        .:|......||::||.:.:|..|: ...::.|.:|:.::..|.
  Fly   159 KVPQLKATWHLANS--------AILETNGTKVGVIGYLTPDTKKLT-LNMDVEFNEEVESINVEA 214

Human   205 DKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTS 269
            .|||...:..||||||||:..|..||:....||:|:|||:|||||||..|..|...|.||.:|..
  Fly   215 KKLKAQGIKIIIALGHSGYLKDLEIAKNCPEVDIVIGGHTNTFLYTGAQPDAEHIDGPYPTMVKQ 279

Human   270 DDGRKVPVVQAYAFGKYLGYLKIEFDERGNVISSHGNPILLNSSIPEDPSIKADINKWRIKLDNY 334
            :.|::||||||||:.||||.|.::||..||:|...|:|||||:|:.::..:...:..:|..:...
  Fly   280 NSGKEVPVVQAYAYTKYLGKLHVQFDADGNLIQWDGSPILLNASVAQEQDLLDLLEVFRPNVTRL 344

Human   335 STQELGKTIVYLDGSSQSCRFRECNMGNLICDAMINNNLRHTDEM---FWNHVSMCILNGGGIRS 396
            ....:|.|.|:|:|:...||..|||:||||.|||:.:.|  .:|.   ||...::.|:.||||||
  Fly   345 EKSVVGHTKVHLEGNKAVCRAEECNLGNLIADAMVFSRL--MEEQGGDFWTDAAISIMQGGGIRS 407

Human   397 PIDERNNGTITWENLAAVLPFGGTFDLVQLKGSTLKKAFEHSVHRYGQ-STGEFLQVGGIHVVYD 460
            .|::|::|.||..::.:|||:|....:|.:.|||:::|.||.....|: |.|.||||.||.||::
  Fly   408 SIEKRSDGAITDNDILSVLPWGNKLYMVPMTGSTIRRALEHGAALRGKDSDGGFLQVSGIRVVFN 472

Human   461 LSRKPGDRVVKLDVLCTKCRVPSYDPLKMDEVYKVILPNFLANGGDGFQMIKDELLRHDSGDQ-- 523
            .::..|.|||.:.|.|..||||:|..|....:|.|:|..||.:||||..|       .||..|  
  Fly   473 SNKPEGQRVVSVQVRCAACRVPTYSDLNDTAIYNVVLGEFLLDGGDGHVM-------RDSAHQPQ 530

Human   524 -----DINVVSTYISKMKVIYPAVEGRIKF-STGSHCHGSFSLIFLS 564
                 |:..||.|:::...:||.:||||.| :..|...||.:|:.:|
  Fly   531 RLQNNDLEAVSQYLNQRDYVYPEIEGRIIFINASSTLMGSAALLLIS 577

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NT5ENP_002517.1 UshA 11..532 CDD:223808 217/533 (41%)
MPP_CD73_N 29..310 CDD:277354 127/297 (43%)
5_nucleotid_C 339..507 CDD:280945 75/172 (44%)
NT5E-2NP_611218.1 MPP_CD73_N 33..320 CDD:277354 127/297 (43%)
nadN 35..520 CDD:211667 207/497 (42%)
5_nucleotid_C 348..519 CDD:280945 75/173 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280633564
eggNOG 1 0.900 E1_COG0737
Hieranoid 1 1.000
Homologene 1 1.000 H1895
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6498
OMA 1 1.010
OrthoDB 1 1.010 D159192at33208
OrthoFinder 1 1.000 FOG0005290
OrthoInspector 1 1.000 T608462
orthoMCL 1 0.900 OOG5_127246
Panther 1 1.100 LDO PTHR11575
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.670

Return to query results.
Submit another query.