DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: boca and Mesd

Sequence 1:NP_724578.1 Gene:boca FlyBaseID:FBgn0004132 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001008346.1 Gene:Mesd RGDID:1310344 Length:224 Species:Rattus norvegicus

Alignment Length:177 Identity:84/178 (47%)
Similarity:122/178 (69%) Gaps:9/178 (5%)


  Fly     4 RLVLLLLALTPLVLAKKFK--------EEEKPAWAKKDIRDYSEADLERLLDQWEEDEEPLEDDE 60
            |.|||.|..:.|:|....:        |...|...|||||||::||:.|||:|||:|:: :|:.:
  Rat     8 RAVLLFLCASDLLLLSPPEAYATDTPGEAITPPRKKKDIRDYNDADMARLLEQWEKDDD-IEEGD 71

  Fly    61 LPEHLRPQPKLDLSNLDSKSPEDLLKVSKKGRTLMTFVSVTGNPTREESDTITKLWQTSLWNNHI 125
            ||||.||...:|.|.||...||.:||::|||:|||.||:::||||.:|::.||.|||.||:|.:.
  Rat    72 LPEHKRPSAPIDFSKLDPGKPESILKMTKKGKTLMMFVTISGNPTEKETEEITSLWQGSLFNANY 136

  Fly   126 QAERYMVDDNRAIFLFKDGTQAWDAKDFLIEQERCKGVTIENKEYPG 172
            ..:|::|..:||||:.:||:.||:.||||:.|:||..||:|.:.|||
  Rat   137 DVQRFIVGSDRAIFMLRDGSYAWEIKDFLVNQDRCAEVTLEGQMYPG 183

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bocaNP_724578.1 Mesd 31..178 CDD:287194 75/143 (52%)
MesdNP_001008346.1 Chaperone domain. {ECO:0000250|UniProtKB:Q9ERE7} 1..155 68/148 (46%)
Mesd 43..192 CDD:287194 75/143 (52%)
Escort domain. {ECO:0000250|UniProtKB:Q9ERE7} 156..195 15/29 (52%)
Prevents secretion from ER 221..224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C256677414
eggNOG 1 0.900 E1_KOG4357
Hieranoid 1 1.000
Homologene 1 1.000 H11347
Inparanoid 1 1.050 174 1.000 Inparanoid score I3924
OMA 1 1.010
OrthoDB 1 1.010 D1590303at2759
OrthoFinder 1 1.000 FOG0004891
OrthoInspector 1 1.000 T1087045
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR17600
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.870

Return to query results.
Submit another query.