DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: boca and bmy-1

Sequence 1:NP_724578.1 Gene:boca FlyBaseID:FBgn0004132 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_495003.2 Gene:bmy-1 WormBaseID:WBGene00017293 Length:186 Species:Caenorhabditis elegans

Alignment Length:186 Identity:83/187 (44%)
Similarity:124/187 (66%) Gaps:17/187 (9%)


  Fly     1 MQTRLVLLLLALTPLVLAKKFKEEEKPAWAKKDIRDYSEADLERLLDQWEE-DEEPLEDDELPEH 64
            |:.|.|.:.|....:.|| ..|::      |||:..|::|:||:|.::||| ||:.||:||.|||
 Worm     1 MKWRTVFIFLLAAHIGLA-NVKQK------KKDLSSYTDAELEKLYEEWEENDEDELEEDEKPEH 58

  Fly    65 LRPQPKLDLSNLDSKS--PEDLLKVSKKGRTLMTFVSVT--GNPTREE----SDTITKLWQTSLW 121
            .|..|:|||.::.:|:  |||||.:||||:|||.||.|.  ..|.|.:    ::..|::||:.|:
 Worm    59 KRKPPQLDLESMKAKAKDPEDLLMMSKKGQTLMLFVGVVDPSQPDRSDIRPFTEKWTQIWQSQLY 123

  Fly   122 NNHIQAERYMVDDNRAIFLFKDGTQAWDAKDFLIEQERCKGVTIENKEYPGVNAKK 177
            |||:..:.:::|||||||:||:|.||::||.||::||....||||.:.:.| .|||
 Worm   124 NNHVDLQVFVIDDNRAIFMFKNGEQAFEAKKFLLKQEFVSEVTIEGQSFDG-PAKK 178

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bocaNP_724578.1 Mesd 31..178 CDD:287194 76/157 (48%)
bmy-1NP_495003.2 Mesd 24..186 CDD:287194 76/157 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C256674742
eggNOG 1 0.900 E1_KOG4357
Hieranoid 1 1.000
Homologene 1 1.000 H11347
Inparanoid 1 1.050 146 1.000 Inparanoid score I2987
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1590303at2759
OrthoFinder 1 1.000 FOG0004891
OrthoInspector 1 1.000 T477518
orthoMCL 1 0.900 OOG5_133284
Panther 1 1.100 LDO PTHR17600
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4085
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.