DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: boca and LOC105946188

Sequence 1:NP_724578.1 Gene:boca FlyBaseID:FBgn0004132 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_012810954.1 Gene:LOC105946188 ID: Length:87 Species:Xenopus tropicalis

Alignment Length:88 Identity:42/89 (47%)
Similarity:66/89 (74%) Gaps:1/89 (1%)


  Fly    42 LERLLDQWEEDEEPLEDDELPEHLRPQPKLDLSNLDSKSPEDLLKVSKKGRTLMTFVSVTGNPTR 106
            :.|||:|||:|:: :|:.::|||.||...:|.|.:|.|:||.:||::|||:|||.|.:|:|.||.
 Frog     1 MARLLEQWEQDDD-IEEGDMPEHRRPPAPVDFSKIDPKNPEGVLKMTKKGKTLMIFATVSGEPTE 64

  Fly   107 EESDTITKLWQTSLWNNHIQAER 129
            :|::.||.|||.||:|.:...:|
 Frog    65 KETEEITSLWQGSLFNANYDIQR 87

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bocaNP_724578.1 Mesd 31..178 CDD:287194 42/89 (47%)
LOC105946188XP_012810954.1 Mesd 1..>87 CDD:287194 41/87 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1590303at2759
OrthoFinder 1 1.000 FOG0004891
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.