DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: boca and mesd

Sequence 1:NP_724578.1 Gene:boca FlyBaseID:FBgn0004132 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_002932283.1 Gene:mesd XenbaseID:XB-GENE-940834 Length:212 Species:Xenopus tropicalis

Alignment Length:172 Identity:85/173 (49%)
Similarity:122/173 (71%) Gaps:5/173 (3%)


  Fly     1 MQTRLVLLLLALTPLVLAKKFKEEEKPAWAKKDIRDYSEADLERLLDQWEEDEEPLEDDELPEHL 65
            |..|:|.|.|.|  ||......||:|.  .|||||||::||:.|||:|||:|:: :|:.::|||.
 Frog     4 MGLRVVCLCLVL--LVGLTAAAEEKKK--KKKDIRDYNDADMARLLEQWEQDDD-IEEGDMPEHR 63

  Fly    66 RPQPKLDLSNLDSKSPEDLLKVSKKGRTLMTFVSVTGNPTREESDTITKLWQTSLWNNHIQAERY 130
            ||...:|.|.:|.|:||.:||::|||:|||.|.:|:|.||.:|::.||.|||.||:|.:...:|:
 Frog    64 RPPAPVDFSKIDPKNPEGVLKMTKKGKTLMIFATVSGEPTEKETEEITSLWQGSLFNANYDIQRF 128

  Fly   131 MVDDNRAIFLFKDGTQAWDAKDFLIEQERCKGVTIENKEYPG 172
            :|..||.||:.:||:.||:.||||:.||||..||:|.:.|||
 Frog   129 IVGSNRVIFMLRDGSYAWEVKDFLVGQERCADVTVEGQVYPG 170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bocaNP_724578.1 Mesd 31..178 CDD:287194 74/143 (52%)
mesdXP_002932283.1 Mesd 32..180 CDD:287194 72/141 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C256677023
eggNOG 1 0.900 E1_KOG4357
Hieranoid 1 1.000
Homologene 1 1.000 H11347
Inparanoid 1 1.050 173 1.000 Inparanoid score I3873
OMA 1 1.010
OrthoDB 1 1.010 D1590303at2759
OrthoFinder 1 1.000 FOG0004891
OrthoInspector 1 1.000 T1059487
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4085
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.