DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src64B and FGFR1

DIOPT Version :10

Sequence 1:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001167538.1 Gene:FGFR1 / 2260 HGNCID:3688 Length:853 Species:Homo sapiens


Alignment Length:648 Identity:181/648 - (27%)
Similarity:264/648 - (40%) Gaps:155/648 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KCCSK----------RQDQELALAYPTGGYKKSDYTFG--QTHINSSGGGNMGGVLGQKHNNGGS 56
            ||.|.          :..:|....:..||||....|:.  ...:..|..||...::   .|..||
Human   208 KCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIV---ENEYGS 269

  Fly    57 LDSRYTPDPNHRGPLKIGGKGGVDIIRPRTTPTGVPGVVLKRVVVALYDYKSRDESDLSFMKGDR 121
            ::..|..|...|.|           .|| ....|:|.    ...|||       .|::.||    
Human   270 INHTYQLDVVERSP-----------HRP-ILQAGLPA----NKTVAL-------GSNVEFM---- 307

  Fly   122 MEVIDDTES--DWWRVVNLTTRQEG--LIPLNFVAEERSVNSEDWFFE-----NVLRKEADK--- 174
            .:|..|.:.  .|.:.:.:...:.|  .:|...:.:...||:.|...|     ||..::|.:   
Human   308 CKVYSDPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTC 372

  Fly   175 -----------------LLLAEENP---------------RGTFLVRPSEHNPNGYSL----SVK 203
                             |...||.|               .|.||:.....:...|.:    ...
Human   373 LAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKS 437

  Fly   204 DWEDGRGYHVKHYRIKPLD-------------NGGYYIATNQTFPSLQALVMAYSKENALGLCHI 255
            |:......| |..:..||.             |.|..:.......|....::|...|..|     
Human   438 DFHSQMAVH-KLAKSIPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYEL----- 496

  Fly   256 LSRPCPKPQPQMWDLGPELRDKYEIPRSEIQLLRKLGRGNFGEVFYG--------KWRNSIDVAV 312
                   |:...|          |:||..:.|.:.||.|.||:|...        |......|||
Human   497 -------PEDPRW----------ELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAV 544

  Fly   313 KTLREGT--MSTAAFLQEAAIMKKF-RHNRLVALYAVCSQEEPIYIVQEYMSKGSLLDFL--REG 372
            |.|:...  ...:..:.|..:||.. :|..::.|...|:|:.|:|::.||.|||:|.::|  |..
Human   545 KMLKSDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRP 609

  Fly   373 DG------------RYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFG 425
            .|            ..|..:||:..|.|||.|||||.||:.|||||||||||:.|:||.||.|||
Human   610 PGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFG 674

  Fly   426 LARVIADDEYCPK-QGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSRE 489
            |||.|...:|..| ...|.||||.||||:....::.:|||||:|:||.|:||.|..||||:...|
Human   675 LARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEE 739

  Fly   490 VIENIERGFRMPKPTNHYFPDNIYQLLLQCWDAVPEKRPTFEFLNHYFESF-SVTSEVPYREV 551
            :.:.::.|.||.||:|  ..:.:|.::..||.|||.:||||:.|....:.. ::||...|.::
Human   740 LFKLLKEGHRMDKPSN--CTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDL 800

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src64BNP_001286937.1 SH2_Src_family 158..259 CDD:199827 25/157 (16%)
PTKc_Src_like 289..538 CDD:270630 112/274 (41%)
SH3_Src_like 99..150 CDD:212779 11/54 (20%)
FGFR1NP_001167538.1 IgI_1_FGFR 58..151 CDD:409362
Ig strand A 58..61 CDD:409362
Ig strand A' 73..79 CDD:409362
Ig strand B 82..92 CDD:409362
Ig strand C 96..101 CDD:409362
Ig strand C' 104..106 CDD:409362
Ig strand D 111..115 CDD:409362
Ig strand E 118..123 CDD:409362
Ig strand F 129..138 CDD:409362
Ig strand G 141..151 CDD:409362
IgI_2_FGFR 184..278 CDD:409443 16/72 (22%)
Ig strand A 184..187 CDD:409443
Ig strand A' 195..200 CDD:409443
Ig strand B 204..212 CDD:409443 2/3 (67%)
Ig strand C 218..223 CDD:409443 0/4 (0%)
Ig strand C' 226..228 CDD:409443 0/1 (0%)
Ig strand D 237..240 CDD:409443 2/2 (100%)
Ig strand E 244..249 CDD:409443 0/4 (0%)
Ig strand F 258..265 CDD:409443 1/9 (11%)
Ig strand G 268..278 CDD:409443 3/9 (33%)
Ig 286..390 CDD:472250 21/119 (18%)
Ig strand B 304..308 CDD:409353 2/7 (29%)
Ig strand C 317..321 CDD:409353 0/3 (0%)
Ig strand E 355..359 CDD:409353 1/3 (33%)
Ig strand F 369..374 CDD:409353 0/4 (0%)
Ig strand G 382..385 CDD:409353 0/2 (0%)
PTKc_FGFR1 495..796 CDD:270678 121/324 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.