DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NRCAM and sdk

Sequence 1:XP_011514555.1 Gene:NRCAM HGNCID:7994 Length:1311 Species:Homo sapiens
Sequence 2:NP_001284756.1 Gene:sdk FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster

Alignment Length:1286 Identity:311/1287 (24%)
Similarity:507/1287 (39%) Gaps:244/1287 (19%)


Human     6 MPKKKRLSAGRVPLILFLCQMISALEVPLDPKLLE--DLVQ------PPTITQQSPKDYIIDPRE 62
            ||.:.:| |..:.:::.||...|......|..|.:  .:||      |...|..|....|:....
  Fly    26 MPSQPKL-ASLLAVLVLLCYCDSCFFCYADANLQQQNSIVQQQQLQAPRFTTHPSSSGSIVSEGS 89

Human    63 NIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGTGTLIINIMSEGKAETYEGVYQCTARN 127
            ..::||.|.|.|.|::.|.::|          |.:...:.:......|..:.:.  |.|||.|||
  Fly    90 TKILQCHALGYPQPTYRWLKDG----------VPVGDFSSSQFYRFHSTRREDA--GSYQCIARN 142

Human   128 ERGAAVSNNIVVRPSRSPLWTKEKLEPITLQSGQSLVLPCRPPIGLPPPIIFWMDNSFQRLPQSE 192
            :.|:..|....|..:...::.......:|:.||...:....|...:|.|.:.|         |||
  Fly   143 DAGSIFSEKSDVVVAYMGIFENTTEGRLTVISGHPAIFDMPPIESIPVPSVMW---------QSE 198

Human   193 RVSQGLNGDLYFSNVLPEDTREDYICYARFNHTQTIQQKQPISVKVISVDELNDTIAANLSDTEF 257
                  :|.|.:.           |.|| |.|..        .:.::|.||         :|.:.
  Fly   199 ------DGPLNYD-----------IKYA-FTHAN--------QLIILSADE---------NDRKG 228

Human   258 YGAKS-----SRERPPTF------------LTPE---GNASNKEELRGNVLSLECIAEGLPTPII 302
            |.||:     .:|....|            :.||   .....|.::...|:.|:|||...|...:
  Fly   229 YRAKAINTQLGKEESSAFVHLNVSGDPYIEVAPEIIVRPQDVKVKVGTGVVELQCIANARPLHEL 293

Human   303 --YWAKEDGMLPK----NRTVYKNFEKTLQIIHVSEADSGNYQCIAKNALGAIHHTISVRVKAAP 361
              .|.| ||:..:    ..|:...:.:||.::..:.:.||.|.|             .||:::..
  Fly   294 ETLWLK-DGLAVETAGVRHTLNDPWNRTLALLQANSSHSGEYTC-------------QVRLRSGG 344

Human   362 Y-WITAPQNL-VLSP------------GEDG---TLICRANGNPKPRISWLTNGVPIEIAPDDPS 409
            | .::|...| :|.|            ||.|   .|.|...|.|.|::.|..|...::...:...
  Fly   345 YPAVSASARLQILEPPLFFTPMRAETFGEFGGQVQLTCDVVGEPTPQVKWFRNAESVDAHIESGR 409

Human   410 RKIDGD-TIIFSNVQERSSAVYQCNASNEYGYLLANAFVNV-----------LAEPPRI------ 456
            ..::.| |::...:....:|::||.|.||.|...|:.::.|           ||: |||      
  Fly   410 YTLNTDNTLVIKKLILDDAAMFQCLAINEAGENSASTWLRVKTKTAKNRVKRLAQ-PRILRVRAS 473

Human   457 ------------------------------LTPANTLYQVIANRPALLDCAFFGSPLPTIEW-FK 490
                                          |.|.|.  ..:..:.|.:.|...|||.|.|.| :.
  Fly   474 HAGLGSEKGSESGSSDRRKEFRFASAPIMELPPQNV--TALDGKDATISCRAVGSPNPNITWIYN 536

Human   491 GAKGSALHEDIYVLHENGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIKDPTWIVKQPEYA 555
            ..:...:...:.:| |:|.|.|...:....|.|.||..|:.|..|.|.:|.:...|.|::.|...
  Fly   537 ETQLVDISSRVQIL-ESGDLLISNIRSVDAGLYICVRANEAGSVKGEAYLSVLVRTQIIQPPVDT 600

Human   556 VVQRGSMVSFECKVKHDHTLSLTVLWLKDNRE---LPSDERFTVDKD-HLVVADVSDDDSGTYTC 616
            .|..|...:.:|||..|.::...:.|.::.:.   :.:.:|..|..| .|.:..|...|.|:|.|
  Fly   601 TVLLGLTATLQCKVSSDPSVPYNIDWYREGQSSTPISNSQRIGVQADGQLEIQAVRASDVGSYAC 665

Human   617 VANTTLDSVSASAVLSVVAPTPTPAPVYDVPNPPFDLE---LTDQLDKSVQLSWTPGDDNNSPIT 678
            |..:...:.:.:|.|||:          ::|.||.:::   |.:...:|:.:|||||.|.||||:
  Fly   666 VVTSPGGNETRAARLSVI----------ELPFPPSNVKVERLPEPQQRSINVSWTPGFDGNSPIS 720

Human   679 KFIIEYEDA-----MHKPGL-WHHQ-TEVSGTQTTAQLK-LSPYVNYSFRVMAVNSIGKSLPSEA 735
            ||||:..:.     :..|.| |..: :.||..|....|: |.....|.|||.|||.:|:..|||.
  Fly   721 KFIIQRREVSELGPVPDPLLNWITELSNVSADQRWILLENLKAATVYQFRVSAVNRVGEGSPSEP 785

Human   736 SEQYLTKASEPDKNPTAVEGLGSEPDNLVITWKPLNGFESNGPGLQYKVSWRQKDGDD-EWTSVV 799
            |.........|...|....|.......::..|:|......||..|.|.:.:|....:: .|:...
  Fly   786 SNVVELPQEAPSGPPVGFVGSARSMSEIITQWQPPLEEHRNGQILGYILRYRLFGYNNVPWSYQN 850

Human   800 VANVSK--YIVSGTPTFVPYLIKVQALNDMGFAPEPAVVMGHSGEDLPMVAPGNVRVNVVNSTLA 862
            :.|.::  :::....|:..|::::.|.|:||...........:.|.:|...|.||:|..:|||.|
  Fly   851 ITNEAQRNFLIQELITWKDYIVQIAAYNNMGVGVYTEGSKIKTKEGVPEAPPTNVKVEAINSTAA 915

Human   863 EVHWDPVPLKSIRGHLQGYRIYYWKTQSSSKRNRRHIEKKILTFQGS------KTHGMLPGLEPF 921
            ...|.|...:.|.|..|||:|..|:.:... ...|.||:::.|...|      :...:|.|||.|
  Fly   916 RCRWTPPNPQQINGINQGYKIQAWQRRLID-GEWRDIERRMKTVPPSLIDPLAEQTAILGGLEKF 979

Human   922 SHYTLNVRVVNGKGEGPASPDRVFNTPEGVPSAPSSLKIVNPTLDSLTLEWDPPSHPNGILTEYT 986
            :.|.::|......|:|.||......|.:.||...:.|...:.:..|:.:.|.||...|||||.||
  Fly   980 TEYNISVLCFTDPGDGVASSQVAVMTMDDVPDEVTGLHFDDVSDRSVKVLWAPPRASNGILTGYT 1044

Human   987 LKYQPINSTHELGPLVDLKIPANKTRWTLKNLNFSTRYKFYFYAQTSAGSGSQITEEAVTTVDEG 1051
            ::||..:..   ..|....:.|:.|..|:..|..:|.|.|...|.|..|||...|    .|:..|
  Fly  1045 VRYQVKDRP---DTLKSFNLTADDTELTVNQLQATTHYWFEIVAWTRVGSGIPKT----ATIQSG 1102

Human  1052 KMAGILPPDVGAGKVQAVNPR------ISNLTAAAAETYANISWEYEGPEHVNFYVEYGVAGSKE 1110
                          |:.|.|.      :||:.|.:  .....:..::|...:..:...|......
  Fly  1103 --------------VEPVLPHAPTALALSNIEAFS--VVLQFTPGFDGNSSITKWKVEGQTARNM 1151

Human  1111 EWRK--EIVNGSRSFFGLKGLMPGTAYKVRVGA---VGDSGFVSSEDVFET 1156
            .|..  ||.:.......:.||:|.|.|::|:.|   ||.|....:...|:|
  Fly  1152 TWFTICEINDPDAETLTVTGLVPFTQYRLRLSASNVVGSSKPSEATKDFQT 1202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NRCAMXP_011514555.1 IG_like 53..139 CDD:214653 20/86 (23%)
Ig6_NrCAM 64..140 CDD:143282 20/76 (26%)
Ig 145..237 CDD:299845 17/92 (18%)
IG_like 153..238 CDD:214653 17/85 (20%)
I-set 268..357 CDD:254352 23/110 (21%)
Ig 288..358 CDD:299845 18/76 (24%)
I-set 361..449 CDD:254352 25/106 (24%)
Ig4_NrCAM 375..450 CDD:143276 21/90 (23%)
I-set 454..542 CDD:254352 28/125 (22%)
IGc2 469..532 CDD:197706 18/64 (28%)
I-set 548..633 CDD:254352 22/89 (25%)
Ig 566..636 CDD:299845 19/74 (26%)
FN3 647..737 CDD:238020 39/101 (39%)
fn3 750..832 CDD:278470 17/85 (20%)
fn3 848..940 CDD:278470 32/98 (33%)
FN3 952..1047 CDD:238020 29/95 (31%)
fn3 1070..1147 CDD:278470 19/88 (22%)
Bravo_FIGEY 1194..1287 CDD:290593
sdkNP_001284756.1 Ig 71..157 CDD:299845 24/98 (24%)
I-set 72..150 CDD:254352 23/90 (26%)
Ig 172..245 CDD:299845 24/117 (21%)
IG_like 280..356 CDD:214653 21/90 (23%)
Ig 280..343 CDD:299845 18/77 (23%)
IG_like 375..450 CDD:214653 18/75 (24%)
Ig 378..447 CDD:143165 17/69 (25%)
Ig 506..587 CDD:299845 24/84 (29%)
IG_like 506..587 CDD:214653 24/84 (29%)
I-set 592..682 CDD:254352 22/90 (24%)
Ig 595..682 CDD:299845 21/87 (24%)
FN3 686..789 CDD:238020 39/103 (38%)
FN3 798..893 CDD:238020 17/95 (18%)
FN3 901..1005 CDD:238020 33/105 (31%)
fn3 1011..1094 CDD:278470 27/86 (31%)
FN3 1108..1202 CDD:238020 20/96 (21%)
FN3 1210..1308 CDD:238020
fn3 1317..1402 CDD:278470
FN3 1415..1507 CDD:238020
FN3 1513..1608 CDD:238020
fn3 1617..1708 CDD:278470
FN3 1722..1823 CDD:238020
FN3 1828..1920 CDD:238020
FN3 1927..2016 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR44170
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.