DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wek and CG31365

Sequence 1:NP_001260472.1 Gene:wek FlyBaseID:FBgn0001990 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster

Alignment Length:481 Identity:107/482 (22%)
Similarity:179/482 (37%) Gaps:115/482 (24%)


  Fly    17 RDDVVYKVRE--RDDDLVRIISKCFDVEMTLE-----------EPELGSMLCEECYSVIGQLITF 68
            |||:..:|.|  |.:.|..::.: .:|.:|.:           |||....:.|:.          
  Fly   191 RDDLRNEVSEDIRKEQLAMLLGE-LEVYLTEKKAGRWESLDGSEPETKPQVKEDA---------- 244

  Fly    69 SDSVSKVQAI-------------------------FELLRHSEPQDSQD--LDALRLEYGLPPAC 106
            |.|.||.:|:                         |.|..:::|.::.|  :|.|.|:..:|...
  Fly   245 SPSRSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAES 309

  Fly   107 KQDLEFL-----DIDDTED-RCSLVEELTISDHSTSPSPDFEAQTVRTRANLKQCNSDPKVLASP 165
            .:|...:     |:..|:: ...::...:..|.:...:|:|:.....|..|:|: :.:.:.....
  Fly   310 GEDFREINMVGSDVVHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKE-DGEIQFSGEK 373

  Fly   166 TASIPEV------ETKRSRRQQFAAKRNSKVYTATESDDEEAILDEDEAVSPPPLKRKRGRPKGS 224
            ...|.:|      |.....:|.|:...|..:....::|.:|          ..||||||      
  Fly   374 PEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDE----------QTPLKRKR------ 422

  Fly   225 GKQKNVDDSDNVTSREPDDNAKSKQDDKTSELSMSPHGSQSSNFVDYPCKICNETFMSFMALRRH 289
                   .|:.|..:|     .|....||        |..:.....:.|.:|...|.:...|.||
  Fly   423 -------SSELVFKQE-----SSCPQPKT--------GRITDTVKSFQCHLCPVAFPTQKLLTRH 467

  Fly   290 KHDMH--------GGPKKYVCDHCGKGLKTFTSLVEHQLVHTEEKPCICPVCNAGFKNKARLRVH 346
             |:.|        ||..|  |..|...|...:||..|.::||..||..|..|...|..:..|:.|
  Fly   468 -HNTHIKGLKSGKGGTLK--CPSCALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRH 529

  Fly   347 SQTH-GEPKFECNVCGKKLQTRAILNKH-KYVHT-DERRFKCEVCGSGCKNSTALKIHLLGHTGL 408
            ..|| |..:.:|..|......::.|.:| ..||. :.|..||.:|.....:.:.|..||:.|.|:
  Fly   530 MDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTHAGV 594

  Fly   409 RPYVCKYCGKAFASNTNCRSHKWKKH 434
            . :.||.||:.|...:..:.|....|
  Fly   595 M-FSCKQCGRQFNDRSAVQRHVTTMH 619

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wekNP_001260472.1 zf-AD 11..80 CDD:214871 19/101 (19%)
C2H2 Zn finger 273..294 CDD:275368 7/21 (33%)
C2H2 Zn finger 302..322 CDD:275368 6/20 (30%)
C2H2 Zn finger 330..350 CDD:275368 6/20 (30%)
C2H2 Zn finger 357..377 CDD:275368 5/21 (24%)
C2H2 Zn finger 385..405 CDD:275368 5/20 (25%)
zf-H2C2_2 397..422 CDD:290200 10/25 (40%)
C2H2 Zn finger 413..429 CDD:275368 5/16 (31%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 13/54 (24%)
RRF <161..222 CDD:294170 9/32 (28%)
zf-C2H2_8 454..530 CDD:292531 25/79 (32%)
C2H2 Zn finger 485..505 CDD:275368 6/20 (30%)
zf-H2C2_2 497..522 CDD:290200 10/25 (40%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 7/24 (29%)
C2H2 Zn finger 541..562 CDD:275368 5/21 (24%)
C2H2 Zn finger 571..591 CDD:275368 5/20 (25%)
C2H2 Zn finger 598..617 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24377
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.