DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mtr4 and MTR4

Sequence 1:NP_524929.1 Gene:Mtr4 FlyBaseID:FBgn0001986 Length:1055 Species:Drosophila melanogaster
Sequence 2:NP_012485.1 Gene:MTR4 SGDID:S000003586 Length:1073 Species:Saccharomyces cerevisiae

Alignment Length:1103 Identity:538/1104 (49%)
Similarity:741/1104 (67%) Gaps:78/1104 (7%)


  Fly     1 MDIEELFDCFDEVTPSVPPPALNQEEKPSGSSASKKGNKRQADGTTASKEATSSKGAEGDDKGDV 65
            ||..:|||.|:| ||         .|.|:.|:..|..:....|  |.........|.| ::|.:.
Yeast     1 MDSTDLFDVFEE-TP---------VELPTDSNGEKNADTNVGD--TPDHTQDKKHGLE-EEKEEH 52

  Fly    66 TEEPTKRLKQEASTVAVDDDNNADDEPTRTLDIDDSATLEALRTRIVTHLLDAPKSCT------- 123
            .|..::..|.:::....:|.|.....|.    :.||...||.|.      :||.|..|       
Yeast    53 EENNSENKKIKSNKSKTEDKNKKVVVPV----LADSFEQEASRE------VDASKGLTNSETLQV 107

  Fly   124 -------------HEVAAHPDQEYIPLKPFSGV-PAKEYPFVLDPFQRQAILCIDNSQSVLVSAH 174
                         |:||..|:.:|.|:.....| .|:.|||.|||||..||.|||..:|||||||
Yeast   108 EQDGKVRLSHQVRHQVALPPNYDYTPIAEHKRVNEARTYPFTLDPFQDTAISCIDRGESVLVSAH 172

  Fly   175 TSAGKTVVAEYAIAKSLAAKQRVIYTTPIKALSNQKFREFTDEFKDVGLVTGDVTINPSASCLIM 239
            ||||||||||||||:||..|||||||:|||||||||:||...||.||||:|||:||||.|.||:|
Yeast   173 TSAGKTVVAEYAIAQSLKNKQRVIYTSPIKALSNQKYRELLAEFGDVGLMTGDITINPDAGCLVM 237

  Fly   240 TTEILRNMLYRGSEIMREVGWVVFDEIHYMRDKERGVVWEETLILLPDNVRYVFLSATIPNARQF 304
            ||||||:|||||||:||||.||:|||:|||||||||||||||:|||||.|||||||||||||.:|
Yeast   238 TTEILRSMLYRGSEVMREVAWVIFDEVHYMRDKERGVVWEETIILLPDKVRYVFLSATIPNAMEF 302

  Fly   305 AEWVCHLHKQPCHVVYTDYRPTPLQHYIFPAGGDGIHLIVDEKGQFKEDNFTTAMAVLAN----- 364
            |||:|.:|.||||:|||::||||||||:|||.||||:|:||||..|:|:||..|||.::|     
Yeast   303 AEWICKIHSQPCHIVYTNFRPTPLQHYLFPAHGDGIYLVVDEKSTFREENFQKAMASISNQIGDD 367

  Fly   365 ---AGEAGKGDQKGRHGGIKGTNAGQTNIFKIVKMIMERNFAPVIIFSFSKKDCEIYAMQMAKLD 426
               ....||..|..:.|..||...|  :|:||||||.::.:.|||:|||||:|||..|::|:|||
Yeast   368 PNSTDSRGKKGQTYKGGSAKGDAKG--DIYKIVKMIWKKKYNPVIVFSFSKRDCEELALKMSKLD 430

  Fly   427 FNTPDEKKLVDEVFNNAMDVLTEEDRRLPQVENVLPLLRRGIGIHHGGLLPILKETIEILFGEGL 491
            ||:.|||:.:.::||||:.:|.|.||.|||::::||||||||||||.||||||||.|||||.||.
Yeast   431 FNSDDEKEALTKIFNNAIALLPETDRELPQIKHILPLLRRGIGIHHSGLLPILKEVIEILFQEGF 495

  Fly   492 IKALFATETFAMGLNMPARTVLFTAPRKFDGKKFRWISSGEYIQMAGRAGRRGLDDKGIVILMID 556
            :|.|||||||::||||||:||:||:.||:||::|||:|.||||||:||||||||||:||||:|||
Yeast   496 LKVLFATETFSIGLNMPAKTVVFTSVRKWDGQQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMID 560

  Fly   557 EKVSPAVGRDIVQGKADPINSAFHLTYNMVLNLLRVEEINPEYMLERSFYQFQNQAALPGLHDQV 621
            ||:.|.|.:.:|:|:||.::|||||.|||:|||:|||.|:||:|||.||:||||..::|    .:
Yeast   561 EKMEPQVAKGMVKGQADRLDSAFHLGYNMILNLMRVEGISPEFMLEHSFFQFQNVISVP----VM 621

  Fly   622 EQKTLELNK----LTIKDEHNIASYHHIRSQLDQHGKQFRQWITKPQYLLPFLQPGRLVKVAA-G 681
            |:|..||.|    :.::||.|:..||.|...:..:.:..||.:|.|...|.||||||||:::. |
Yeast   622 EKKLAELKKDFDGIEVEDEENVKEYHEIEQAIKGYREDVRQVVTHPANALSFLQPGRLVEISVNG 686

  Fly   682 SQEYDWGIVLNFKKQDQSRKNPLKA---EPSVTIDVLLHVSEAAAKTGDTEPCKP---------- 733
            ...|.||.|::|.|: .:::||...   ..|..::|:::.....:.....:|..|          
Yeast   687 KDNYGWGAVVDFAKR-INKRNPSAVYTDHESYIVNVVVNTMYIDSPVNLLKPFNPTLPEGIRPAE 750

  Fly   734 -NERGCMEVVPVAHTLITQISSIRVYFPNDLRSADNRRAVLKTIQEAKKRFPLGPPVLNPIDDMN 797
             .|:....|:|:....|..|.::|:|.|.|:|::..:..|.|:::|..:|||.|.|||:|:.:|.
Yeast   751 EGEKSICAVIPITLDSIKSIGNLRLYMPKDIRASGQKETVGKSLREVNRRFPDGIPVLDPVKNMK 815

  Fly   798 IKDREFRDIVNTISQFEKRLEEHPLHKSPELERIHRRYQDKVTLQKQLQDLKAELKAARSLLQMD 862
            |:|.:|..::..|.....:|..:||..|..||.::.:|..|..|.:.::.||.::..:::::|:|
Yeast   816 IEDEDFLKLMKKIDVLNTKLSSNPLTNSMRLEELYGKYSRKHDLHEDMKQLKRKISESQAVIQLD 880

  Fly   863 ELKHRKRVLRRMGYCKPGDVIEFKGRVACELSSADELLMTEMIFNGVFNDLTAPQAVALLSCFVC 927
            :|:.|||||||:|:|.|.|:||.|||||||:||.||||:||:||||.||:|...||.||||||..
Yeast   881 DLRRRKRVLRRLGFCTPNDIIELKGRVACEISSGDELLLTELIFNGNFNELKPEQAAALLSCFAF 945

  Fly   928 DEKSSESVKSATELSGPLRSMQDLARRIAKVSTECKLDLDADTYVDKFKPFLMDVVLAWCKGSSF 992
            .|:..|:.:...||:.||::|:::|.:|||:..:.|:::....||:.|:..||:||..||:|::|
Yeast   946 QERCKEAPRLKPELAEPLKAMREIAAKIAKIMKDSKIEVVEKDYVESFRHELMEVVYEWCRGATF 1010

  Fly   993 LAVCKMTDIFEGSIIRCMRRLEELLRQMCQASKTIGNTDLENKFSEGIRLLKRDIVFAASLYL 1055
            ..:|||||::|||:||..:|||||::::...:.||||:.|:.|....::|:.||||.|.||||
Yeast  1011 TQICKMTDVYEGSLIRMFKRLEELVKELVDVANTIGNSSLKEKMEAVLKLIHRDIVSAGSLYL 1073

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mtr4NP_524929.1 Dob10 91..1055 CDD:226947 515/1012 (51%)
DEAD 154..299 CDD:278688 118/145 (81%)
HELICc 390..554 CDD:238034 112/164 (68%)
rRNA_proc-arch 600..853 CDD:289976 84/272 (31%)
DSHCT 881..1048 CDD:285374 81/167 (49%)
MTR4NP_012485.1 Dob10 21..1073 CDD:226947 526/1072 (49%)
DEAD 152..302 CDD:278688 121/150 (81%)
HELICc 393..558 CDD:238034 112/165 (68%)
rRNA_proc-arch 604..871 CDD:289976 84/272 (31%)
DSHCT 899..1066 CDD:285374 81/167 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C323881629
eggNOG 1 0.900 E1_COG4581
Hieranoid 1 1.000
Homologene 1 1.000 H6257
Inparanoid 1 1.050 1025 1.000 Inparanoid score I26
Isobase 1 0.950 0 Normalized mean entropy S388
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000864
OrthoInspector 1 1.000 T1136993
orthoMCL 1 0.900 OOG5_127259
Panther 1 1.100 LDO PTHR12131
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R764
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.