DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mtr4 and MTR4

Sequence 1:NP_524929.1 Gene:Mtr4 FlyBaseID:FBgn0001986 Length:1055 Species:Drosophila melanogaster
Sequence 2:NP_176185.1 Gene:MTR4 AraportID:AT1G59760 Length:988 Species:Arabidopsis thaliana

Alignment Length:995 Identity:486/996 (49%)
Similarity:682/996 (68%) Gaps:40/996 (4%)


  Fly    85 DNNADDEPTRTLDIDDSATLEALRTRIVTHLLDAPKSCTHEVAAHPDQEYIPLKP--FSGVPAKE 147
            :.::|..|.:.:..:|.:| :.:...:|        .|.|:|:.  .:.|:||.|  .:..|||:
plant    10 EESSDSAPPQKVQREDDST-QIINEELV--------GCVHDVSF--PENYVPLAPSVHNKPPAKD 63

  Fly   148 YPFVLDPFQRQAILCIDNSQSVLVSAHTSAGKTVVAEYAIAKSLAAKQRVIYTTPIKALSNQKFR 212
            :||.||.||.:||.|:||.:||:|||||||||||||.||||.||...||||||:|||||||||:|
plant    64 FPFTLDSFQSEAIKCLDNGESVMVSAHTSAGKTVVASYAIAMSLKENQRVIYTSPIKALSNQKYR 128

  Fly   213 EFTDEFKDVGLVTGDVTINPSASCLIMTTEILRNMLYRGSEIMREVGWVVFDEIHYMRDKERGVV 277
            :|.:||.||||:||||||:|:||||:|||||||:|.|:||||||||.|::|||:|||||.|||||
plant   129 DFKEEFSDVGLMTGDVTIDPNASCLVMTTEILRSMQYKGSEIMREVAWIIFDEVHYMRDSERGVV 193

  Fly   278 WEETLILLPDNVRYVFLSATIPNARQFAEWVCHLHKQPCHVVYTDYRPTPLQHYIFPAGGDGIHL 342
            |||::::.|.|.|:||||||:|||::||:||..:|:||||:|||||||||||||:|||||:|::|
plant   194 WEESIVMAPKNSRFVFLSATVPNAKEFADWVAKVHQQPCHIVYTDYRPTPLQHYVFPAGGNGLYL 258

  Fly   343 IVDEKGQFKEDNFTTAMAVLANAGEAGKGDQKGR--HGGIKGTNAGQTNIFKIVKMIMERNFAPV 405
            :||||.:|.||:|..::..|....|:.|....|:  .|.:.|....:::|||:||||::|.:.||
plant   259 VVDEKSKFHEDSFQKSLNALVPTNESDKKRDNGKFQKGLVIGKLGEESDIFKLVKMIIQRQYDPV 323

  Fly   406 IIFSFSKKDCEIYAMQMAKLDFNTPDEKKLVDEVFNNAMDVLTEEDRRLPQVENVLPLLRRGIGI 470
            |:||||||:||..||||:|:..|:.|||..|:.:|.:|:|:|:::|::||||.|:||:|:||||:
plant   324 ILFSFSKKECEALAMQMSKMVLNSDDEKDAVETIFASAIDMLSDDDKKLPQVSNILPILKRGIGV 388

  Fly   471 HHGGLLPILKETIEILFGEGLIKALFATETFAMGLNMPARTVLFTAPRKFDGKKFRWISSGEYIQ 535
            ||.||||||||.|||||.|||||.|||||||::||||||:||:||..|||||.||||:|||||||
plant   389 HHSGLLPILKEVIEILFQEGLIKCLFATETFSIGLNMPAKTVVFTNVRKFDGDKFRWLSSGEYIQ 453

  Fly   536 MAGRAGRRGLDDKGIVILMIDEKVSPAVGRDIVQGKADPINSAFHLTYNMVLNLLRVEEINPEYM 600
            |:|||||||:|.:||.|||:|||:.|||.:.:::|.||.:||||||:|||:||.||.||.:||.:
plant   454 MSGRAGRRGIDKRGICILMVDEKMEPAVAKSMLKGSADSLNSAFHLSYNMLLNQLRCEEGDPENL 518

  Fly   601 LERSFYQFQNQAALPGLHDQVEQKTLELNKLTIKDEHNIASYHHIRSQLDQHGKQFRQWITKPQY 665
            |..||:|||...|:|.|..|::....|.:.|.|::|.::.:|:::..|.....|..|:.:..|:|
plant   519 LRNSFFQFQADRAIPDLEKQIKSLEEERDSLVIEEEESLKNYYNLILQYKSLKKDIREIVFTPKY 583

  Fly   666 LLPFLQPGRLVKVAAGSQEYD-----------WGIVLNFKK-----QDQSRKNPLKAEPSVTIDV 714
            .||||.|.|.|.:...:.:.:           ||:::.|.|     :|...:.|  .:.:.|:||
plant   584 CLPFLLPNRAVCLDCTNDDEEPQSFSIEDQDTWGVIMKFNKVKSLSEDDDSRRP--EDANYTVDV 646

  Fly   715 LLHVSEAAAKTGDTE----PCKPNERGCMEVVPVAHTLITQISSIRVYFPNDLRSADNRRAVLKT 775
            |.....:....|..:    |.|  |||...||.|..:.|..:||..:..|.||...:.|...||.
plant   647 LTRCMVSKDGVGKKKVKAVPIK--ERGEPVVVTVPLSQIKSLSSAIMNIPKDLVPLEARENALKK 709

  Fly   776 IQEAKKRFPLGPPVLNPIDDMNIKDREFRDIVNTISQFEKRLEEHPLHKSPELERIHRRYQDKVT 840
            :.|...|.|.|.| |:|..||.||...::..|..:...|...|:|.:.|||.:....:..|.|..
plant   710 VSELLSRHPDGIP-LDPEVDMKIKSSSYKKTVRRLEALENLFEKHKIAKSPLITEKLKVLQMKEE 773

  Fly   841 LQKQLQDLKAELKAARSLLQMDELKHRKRVLRRMGYCKPGDVIEFKGRVACELSSADELLMTEMI 905
            |..:::.||..::::.:|...||||.|||||||:||....:|:|.||:||||:|||:||.:||::
plant   774 LIAKIKSLKKTVRSSTALAFKDELKARKRVLRRLGYITSDNVVELKGKVACEISSAEELTLTELM 838

  Fly   906 FNGVFNDLTAPQAVALLSCFVCDEKSSESVKSATELSGPLRSMQDLARRIAKVSTECKLDLDADT 970
            |:|:|.|....:.|:||||||..|:..::.|...||......:||.|||:|:|..:||:::|.::
plant   839 FSGIFKDAKVEELVSLLSCFVWRERLPDAAKPREELDLLFIQLQDTARRVAEVQLDCKVEIDVES 903

  Fly   971 YVDKFKPFLMDVVLAWCKGSSFLAVCKMTDIFEGSIIRCMRRLEELLRQMCQASKTIGNTDLENK 1035
            :|..|:|.:|:.|.||.|||.|..|.::..:||||:||.:||:||:|:|:..|:|:||.|.||.|
plant   904 FVQSFRPDIMEAVYAWAKGSKFYEVMEIARVFEGSLIRAIRRMEEVLQQLIVAAKSIGETQLEAK 968

  Fly  1036 FSEGIRLLKRDIVFAASLYL 1055
            ..|.:..:||||||||||||
plant   969 LEEAVSKIKRDIVFAASLYL 988

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mtr4NP_524929.1 Dob10 91..1055 CDD:226947 484/988 (49%)
DEAD 154..299 CDD:278688 105/145 (72%)
HELICc 390..554 CDD:238034 112/164 (68%)
rRNA_proc-arch 600..853 CDD:289976 78/273 (29%)
DSHCT 881..1048 CDD:285374 77/167 (46%)
MTR4NP_176185.1 Dob10 40..988 CDD:226947 479/955 (50%)
DEAD 72..220 CDD:278688 107/148 (72%)
HELICc 305..472 CDD:238034 112/167 (67%)
rRNA_proc-arch 518..786 CDD:289976 78/273 (29%)
DSHCT 814..981 CDD:285374 77/167 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6257
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D176060at2759
OrthoInspector 1 1.000 T192731
orthoMCL 1 0.900 OOG5_127259
Panther 1 1.100 LDO PTHR12131
Phylome 1 0.910 0.667 Consistency score
87.930

Return to query results.
Submit another query.