DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mtr4 and AT3G46960

Sequence 1:NP_524929.1 Gene:Mtr4 FlyBaseID:FBgn0001986 Length:1055 Species:Drosophila melanogaster
Sequence 2:NP_190280.5 Gene:AT3G46960 AraportID:AT3G46960 Length:1347 Species:Arabidopsis thaliana

Alignment Length:1200 Identity:398/1200 (33%)
Similarity:603/1200 (50%) Gaps:223/1200 (19%)


  Fly    19 PPALNQ-----------------EEKPSGSSASKKGNKR---------------------QADGT 45
            ||:..|                 |:..|..:||.:.:.:                     :.|..
plant   205 PPSFKQSLDLGDLMPYPQTWSVYEDHSSHGNASDENSSKLSIQFDDLFKKAWEEDTFSELEGDDH 269

  Fly    46 TASKEATSSKGAEGDDKGDVTEEPTKRLKQEASTVAVDDDNNADDEPTRTLDIDDSATLEALRTR 110
            ||..|:..:: ||.|.|..::.|.:|.|:.:.:.:         ||      |..||....:...
plant   270 TAGSESPKAE-AEPDAKASISNEVSKGLETDVTVL---------DE------ILSSAKTAIMSEE 318

  Fly   111 IVTHLLD--------APKSCTHEVAAHPDQEYIPLKPFSGVPAKEYPFVLDPFQRQAILCIDNSQ 167
            .||...|        |.|..:.::|    ..:..|.|...:   |:||.||.||::||.|::..:
plant   319 AVTGSSDKQLRKEGWATKGDSQDIA----DRFYELVPDMAI---EFPFELDNFQKEAICCLEKGE 376

  Fly   168 SVLVSAHTSAGKTVVAEYAIAKSLAAKQ--RVIYTTPIKALSNQKFREFTDEFKDVGLVTGDVTI 230
            ||.|:||||||||||||||.|  ||.|.  |.:||.|||.:||||:|:|..:| ||||:||||:|
plant   377 SVFVAAHTSAGKTVVAEYAFA--LATKHCTRAVYTAPIKTISNQKYRDFCGKF-DVGLLTGDVSI 438

  Fly   231 NPSASCLIMTTEILRNMLYRGSEIMREVGWVVFDEIHYMRDKERGVVWEETLILLPDNVRYVFLS 295
            .|.||||||||||||:|||||::|:|::.||:|||:||:.|.||||||||.:|:||.::.:|.||
plant   439 RPEASCLIMTTEILRSMLYRGADIIRDIEWVIFDEVHYVNDVERGVVWEEVIIMLPRHINFVLLS 503

  Fly   296 ATIPNARQFAEWVCHLHKQPCHVVYTDYRPTPLQHYIFPAG------GDGIHL---IVDEKGQFK 351
            ||:||..:||:|:....::...|..|..||.||:|.:|.:|      .:.:.|   |.|.|...|
plant   504 ATVPNTFEFADWIGRTKQKEIRVTGTTKRPVPLEHCLFYSGELYKVCENEVFLSKGIKDAKDSQK 568

  Fly   352 EDNFTTAMAVL------ANAGEAGKGDQK---------GRHGGIKGT-------NAGQTNIFK-- 392
            :.| :.|::|.      ::|.:.|...||         .:|..:|..       |:.....|:  
plant   569 KKN-SNAVSVAPKQQMGSSAHQDGSKSQKHEAHSRGKQNKHSSVKDVGKSSYSGNSQNNGAFRRS 632

  Fly   393 -------IVKMIMERNFAPVIIFSFSKKDCEIYAMQMAKLDFNTPDEKKLVDEVFNNAMDVLTEE 450
                   ::..:.:.:..||::|.|||..|:..|..:...|..:..||..:....:.|...|...
plant   633 AASNWLLLINKLSKMSLLPVVVFCFSKNYCDRCADALTGTDLTSSSEKSEIRVFCDKAFSRLKGS 697

  Fly   451 DRRLPQVENVLPLLRRGIGIHHGGLLPILKETIEILFGEGLIKALFATETFAMGLNMPARTVLFT 515
            ||.||||..:..||.||||:||.|||||:||.:|:||..|:||.||:|||||||:|.|||||:|.
plant   698 DRNLPQVLRLQSLLHRGIGVHHAGLLPIVKEVVEMLFCRGVIKVLFSTETFAMGVNAPARTVVFD 762

  Fly   516 APRKFDGKKFRWISSGEYIQMAGRAGRRGLDDKGIVILMI-DEKVSPAVGRDIVQGKADPINSAF 579
            |.||||||:||.:..|||.||||||||||||..|.|::|. ||....:..|.::.|.|..:.|.|
plant   763 ALRKFDGKEFRQLLPGEYTQMAGRAGRRGLDKTGTVVVMCRDEVPDESDLRRVIVGSATRLESQF 827

  Fly   580 HLTYNMVLNLLRVEEINPEYMLERSFYQFQNQAALPGLHDQVEQKTLELNKLT--------IKDE 636
            .|||.|:|:||||||:..|.||:|||.:|..|..||      |::.|.:.|.:        ||.|
plant   828 RLTYIMILHLLRVEELKVEDMLKRSFAEFHAQKKLP------EKQQLLMIKRSLPTKHIECIKGE 886

  Fly   637 HNIASYHHIRSQLDQHGKQFRQWITKPQYLLPFLQPGRLVKVAAG-------------------- 681
            ..|..|:.:..:.:::..:..:.:.:..|...||..||:|.:.:|                    
plant   887 PAIEDYYDMYMEANEYNNKMSEAVMQSPYAQSFLVQGRVVVMKSGMGIDNLLGIVLKGPSNTNRQ 951

  Fly   682 ---------------------------SQEY------DWGIVLNFKKQDQSRKNPLKAEPSVTID 713
                                       ||.|      ..|....|..:..|||.|      |.|.
plant   952 YVVLVIKSEIPPPEKNMVSIGKKSSDPSQGYFIAPKSKRGFEEEFYTKPSSRKGP------VVIK 1010

  Fly   714 VLLHVSEAAAKTGDTEPCKPNERGCMEVVPVAHTLITQISSIRVYFPNDLRSADNRRAVLKTIQE 778
            :.|.....||..|.......|:    |.:.:..:.| :|..:|      |....|:.|..:|:|:
plant  1011 IELPYHGVAAGVGYEVKGFDNK----EFLCICDSKI-KIDQVR------LLEDGNKAAFSQTVQQ 1064

  Fly   779 A------KKRFPLGPPVLNPIDDMNIKDREFRDIVNTISQFEKRLEEHPLHKSPELERIHRRYQD 837
            .      ..:|   ||.|:|:.|:.:||.|   :|.|..::...|::..::|.....::    ::
plant  1065 LLDLKSDGNKF---PPALDPVKDLKLKDAE---LVETYYKWTNLLQKMSMNKCHGCVKL----EE 1119

  Fly   838 KVTLQKQLQDLKAELK------AARSLLQMDELKHRKRVLRRMGYCKPGDVIEFKGRVACELSSA 896
            .:.|.::::..|.:||      :..:||||...:.|..||:.:|......|::.|||||||::|.
plant  1120 HMKLAREIKKHKTDLKDLEFQMSDEALLQMPAFQGRIDVLKNIGCIDDDLVVQIKGRVACEMNSG 1184

  Fly   897 DELLMTEMIFNGVFNDLTAPQAVALLSCFVCDEKSSESVKSATELSGPLRSMQDLARRIAKVSTE 961
            :||:.|..:|...|.:|...:|||::|.||..:|::.:.....:|:...:.:.|.|.|:.::..:
plant  1185 EELICTVCLFENQFEELEPEEAVAIMSAFVFQQKNTSAPTLTPKLAKAKQRLYDTAIRLGELQAQ 1249

  Fly   962 CKLDLDADTYVDKFKPF-LMDVVLAWCKGSSFLAVCKMTDIFEGSIIRCMRRLEELLRQMCQASK 1025
            ..|.:|.:.|..:...| |::||..|.||:.|..:|::||:.||.|:|.:.||:|..|:...|:.
plant  1250 YNLQIDPEEYAQENLKFGLVEVVYEWAKGTPFAEICELTDVPEGLIVRTIVRLDETCREFKNAAA 1314

  Fly  1026 TIGNTDLENKFSEGIRLLKRDIVFAASLYL 1055
            .:||:.|..|.......:|||||||||||:
plant  1315 IMGNSALHKKMDAASNAIKRDIVFAASLYV 1344

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mtr4NP_524929.1 Dob10 91..1055 CDD:226947 379/1089 (35%)
DEAD 154..299 CDD:278688 92/147 (63%)
HELICc 390..554 CDD:238034 83/173 (48%)
rRNA_proc-arch 600..853 CDD:289976 65/320 (20%)
DSHCT 881..1048 CDD:285374 57/168 (34%)
AT3G46960NP_190280.5 Dob10 264..1343 CDD:226947 390/1139 (34%)
DEAD 365..509 CDD:278688 93/147 (63%)
HELICc 711..791 CDD:197757 57/80 (71%)
rRNA_proc-arch 848..1142 CDD:289976 66/327 (20%)
DSHCT 1169..1337 CDD:285374 57/168 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D176060at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.