DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mtr4 and Mtrex

Sequence 1:NP_524929.1 Gene:Mtr4 FlyBaseID:FBgn0001986 Length:1055 Species:Drosophila melanogaster
Sequence 2:NP_082427.1 Gene:Mtrex MGIID:1919448 Length:1040 Species:Mus musculus

Alignment Length:1065 Identity:665/1066 (62%)
Similarity:819/1066 (77%) Gaps:44/1066 (4%)


  Fly     4 EELFDCFDEVTPSVPPPALNQEEK----PSGSSASKKGNKRQADGTTASKEATSSKGAEGDDKGD 64
            :|||..|::.:.|......::|::    |.| ||.|.|.:..   |....|:.|.    |.:|.|
Mouse     7 DELFSVFEDDSTSAAGAKKDKEKEKWKGPPG-SADKAGKRLD---TKLQSESASG----GKNKRD 63

  Fly    65 VTEEPTKRLKQEASTVAVDDDNNADDEP-----TRTLD-IDDSATLEALRTRIVTHLLDAPKSCT 123
            :..|.|                   |||     .|..| |::..:|..|..|:....::..:.||
Mouse    64 LDVEGT-------------------DEPIFGKKPRIEDSINEDLSLADLMPRVKVQSVETVEGCT 109

  Fly   124 HEVAAHPDQEYIPLKPFSGVPAKEYPFVLDPFQRQAILCIDNSQSVLVSAHTSAGKTVVAEYAIA 188
            ||||...|::||||||..|..||||||:||.|||:||.|:||:|||||||||||||||.||||||
Mouse   110 HEVALPADEDYIPLKPRVGKAAKEYPFILDAFQREAIQCVDNNQSVLVSAHTSAGKTVCAEYAIA 174

  Fly   189 KSLAAKQRVIYTTPIKALSNQKFREFTDEFKDVGLVTGDVTINPSASCLIMTTEILRNMLYRGSE 253
            .:|..|||||:|:|||||||||:||..:||:||||:||||||||:||||:|||||||:|||||||
Mouse   175 LALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRGSE 239

  Fly   254 IMREVGWVVFDEIHYMRDKERGVVWEETLILLPDNVRYVFLSATIPNARQFAEWVCHLHKQPCHV 318
            :||||.||:|||||||||.|||||||||:|||||||.|||||||||||||||||:||||||||||
Mouse   240 VMREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPCHV 304

  Fly   319 VYTDYRPTPLQHYIFPAGGDGIHLIVDEKGQFKEDNFTTAMAVLANAGEAGKGDQKGRHGGIKGT 383
            :||||||||||||||||||||:||:|||.|.|:||||.|||.||.:||:..|||||||.||.|  
Mouse   305 IYTDYRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGDQKGRKGGTK-- 367

  Fly   384 NAGQTNIFKIVKMIMERNFAPVIIFSFSKKDCEIYAMQMAKLDFNTPDEKKLVDEVFNNAMDVLT 448
              |.:|:||||||||||||.|||||||||||||.||:||.||||||.:|||:|:||||||:|.|:
Mouse   368 --GPSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMTKLDFNTDEEKKMVEEVFNNAIDCLS 430

  Fly   449 EEDRRLPQVENVLPLLRRGIGIHHGGLLPILKETIEILFGEGLIKALFATETFAMGLNMPARTVL 513
            :||::|||||:|||||:||||||||||||||||||||||.||||||||||||||||:||||||||
Mouse   431 DEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLIKALFATETFAMGINMPARTVL 495

  Fly   514 FTAPRKFDGKKFRWISSGEYIQMAGRAGRRGLDDKGIVILMIDEKVSPAVGRDIVQGKADPINSA 578
            ||..||:|||.||||||||||||:|||||||:||:||||||:|||:||.:|:.:::|.|||:|||
Mouse   496 FTNARKYDGKDFRWISSGEYIQMSGRAGRRGMDDRGIVILMVDEKMSPTIGKQLLKGSADPLNSA 560

  Fly   579 FHLTYNMVLNLLRVEEINPEYMLERSFYQFQNQAALPGLHDQVEQKTLELNKLTIKDEHNIASYH 643
            ||||||||||||||||||||||||:||||||:..|:||:.::|:....:.||:.|.:|.|:..|:
Mouse   561 FHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPGVVEKVKNSEEQYNKIVIPNEENVVIYY 625

  Fly   644 HIRSQLDQHGKQFRQWITKPQYLLPFLQPGRLVKVAAGSQEYDWGIVLNFKKQDQSRKNPLKAEP 708
            .||.||.:.||:..::|.||:|.||||||||||||.....::.||:|:||.|:...:.|..:.:|
Mouse   626 KIRQQLAKLGKEIEEYIHKPKYCLPFLQPGRLVKVKNEGDDFGWGVVVNFSKKSNVKPNSGELDP 690

  Fly   709 SVTIDVLLHVSEAAAKTGDTE---PCKPNERGCMEVVPVAHTLITQISSIRVYFPNDLRSADNRR 770
            ...::|||..|:.:.|...||   |.||:|:|.|:||||...|::.||::|:|.|.|||..|||:
Mouse   691 LYVVEVLLRCSKESLKNSATEAAKPAKPDEKGEMQVVPVLVHLLSAISTVRLYIPKDLRPVDNRQ 755

  Fly   771 AVLKTIQEAKKRFPLGPPVLNPIDDMNIKDREFRDIVNTISQFEKRLEEHPLHKSPELERIHRRY 835
            :|||:|||.::|||.|.|:|:|||||.|:|:..:.::..:..||.|:..||||..|.||.::...
Mouse   756 SVLKSIQEVQRRFPDGVPLLDPIDDMGIQDQGLKKVIQKVEAFEHRMYSHPLHNDPNLETVYTLC 820

  Fly   836 QDKVTLQKQLQDLKAELKAARSLLQMDELKHRKRVLRRMGYCKPGDVIEFKGRVACELSSADELL 900
            :.|..:...::..|.|||.||::|||||||.|||||||:|:....||||.|||||||:|||||||
Mouse   821 ERKAQIALDIKSAKRELKKARTVLQMDELKCRKRVLRRLGFATSSDVIEMKGRVACEISSADELL 885

  Fly   901 MTEMIFNGVFNDLTAPQAVALLSCFVCDEKSSESVKSATELSGPLRSMQDLARRIAKVSTECKLD 965
            :|||:|||:||||::.||.|||||||..|.|||..|...:|:||||.||:.|:||||||.|.||:
Mouse   886 LTEMMFNGLFNDLSSEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQECAKRIAKVSAEAKLE 950

  Fly   966 LDADTYVDKFKPFLMDVVLAWCKGSSFLAVCKMTDIFEGSIIRCMRRLEELLRQMCQASKTIGNT 1030
            :|.:||:..|||.|||||..|..|::|..:|||||:||||||||||||||||||||||:|.||||
Mouse   951 IDEETYLSSFKPHLMDVVYTWATGATFAHICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIGNT 1015

  Fly  1031 DLENKFSEGIRLLKRDIVFAASLYL 1055
            :|||||:|||..:||||||||||||
Mouse  1016 ELENKFAEGITKIKRDIVFAASLYL 1040

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mtr4NP_524929.1 Dob10 91..1055 CDD:226947 643/973 (66%)
DEAD 154..299 CDD:278688 118/145 (81%)
HELICc 390..554 CDD:238034 138/164 (84%)
rRNA_proc-arch 600..853 CDD:289976 111/256 (43%)
DSHCT 881..1048 CDD:285374 117/167 (70%)
MtrexNP_082427.1 Dob10 92..1040 CDD:226947 637/952 (67%)
DEAD 142..285 CDD:278688 117/143 (82%)
DEIH box 250..253 3/3 (100%)
HELICc 372..536 CDD:238034 138/164 (84%)
rRNA_proc-arch 582..838 CDD:289976 111/256 (43%)
DSHCT 866..1033 CDD:285374 117/167 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C323867995
eggNOG 1 0.900 E1_COG4581
Hieranoid 1 1.000
Homologene 1 1.000 H6257
Inparanoid 1 1.050 1326 1.000 Inparanoid score I145
Isobase 1 0.950 0 Normalized mean entropy S388
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000864
OrthoInspector 1 1.000 T1085724
orthoMCL 1 0.900 OOG5_127259
Panther 1 1.100 LDO PTHR12131
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R764
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.