DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mtr4 and skiv2l

Sequence 1:NP_524929.1 Gene:Mtr4 FlyBaseID:FBgn0001986 Length:1055 Species:Drosophila melanogaster
Sequence 2:XP_005170104.1 Gene:skiv2l ZFINID:ZDB-GENE-010430-5 Length:1249 Species:Danio rerio

Alignment Length:1134 Identity:389/1135 (34%)
Similarity:579/1135 (51%) Gaps:181/1135 (16%)


  Fly     1 MDIEELFDCFDEVTPSVPP--------------PALNQEE----KPSGSSASKKGNKRQADGTTA 47
            :::..|...||:|..:.|.              |..|..|    |.||||        |..|.| 
Zfish   215 VNLLSLLSTFDDVLDAPPEDKEGVSQKEEIVKLPRTNSLEDLGIKDSGSS--------QPQGNT- 270

  Fly    48 SKEATSSKGAEGDDKGDVTEEPTKRLKQEASTVAVDDDNNADDEPTRTLDIDDSATLEALRTRIV 112
                           |.:||:..|.|::|..           |.....:.:|.|:.......|| 
Zfish   271 ---------------GSLTEQKKKNLEEEKG-----------DNKKWAIPVDISSPCADFYKRI- 308

  Fly   113 THLLDAPKSCTHEVAAHPDQEYIPLKPFSGVPAKEYPFVLDPFQRQAILCIDNSQSVLVSAHTSA 177
                             ||            ||.:|||.||.||:||||.::...||.|:|||||
Zfish   309 -----------------PD------------PAFKYPFELDVFQKQAILRLEAHDSVFVAAHTSA 344

  Fly   178 GKTVVAEYAIAKSLAAKQRVIYTTPIKALSNQKFREFTDEFKDVGLVTGDVTINPSASCLIMTTE 242
            |||||||||||.|.....|.|||:|||||||||||:|.:.|.||||:||||.:||..||||||||
Zfish   345 GKTVVAEYAIALSQKHMTRTIYTSPIKALSNQKFRDFKNTFGDVGLLTGDVQLNPEGSCLIMTTE 409

  Fly   243 ILRNMLYRGSEIMREVGWVVFDEIHYMRDKERGVVWEETLILLPDNVRYVFLSATIPNARQFAEW 307
            |||:|||.|||::|::.||:|||:||:.|.||||||||.||:||::|..:.||||:|||.:|:||
Zfish   410 ILRSMLYNGSEVIRDLEWVIFDEVHYINDAERGVVWEEVLIMLPEHVSIILLSATVPNAVEFSEW 474

  Fly   308 VCHLHKQPCHVVYTDYRPTPLQHYIFPAGG----DGIHLIVDEKGQFKEDNFTTAMAVLANAGEA 368
            :..:.|:..:|:.|..||.||:||::....    ..:.:::|..|.|....:..|:       ||
Zfish   475 IGRIKKRHIYVISTIKRPVPLEHYLYTGNSTKTQKELFMLLDATGNFLTKGYYAAV-------EA 532

  Fly   369 GKGDQKGRHGGIKGT-NAGQTNIF---------KIVKMIMERNFAPVIIFSFSKKDCEIYAMQMA 423
             |.::..:|....|| |..|.|..         .::..:.:|...||:.|:||:..|:..|..:.
Zfish   533 -KKERTSKHAQSFGTKNVSQHNTTASQDRAVWQTLLNYLSQRQQTPVVAFTFSRTRCDENARSLT 596

  Fly   424 KLDFNTPDEKKLVDEVFNNAMDVLTEEDRRLPQVENVLPLLRRGIGIHHGGLLPILKETIEILFG 488
            .||..|..||..:......::..|...||:|||:..:..||:||||:||.|:||||||.||:||.
Zfish   597 SLDLTTSIEKSEIHSFLQKSLTRLRGGDRQLPQILLMRDLLKRGIGVHHSGILPILKEVIEMLFS 661

  Fly   489 EGLIKALFATETFAMGLNMPARTVLFTAPRKFDGKKFRWISSGEYIQMAGRAGRRGLDDKGIVIL 553
            .||:|.||||||||||:|||||||:|.:.||.||..||.:..||||||||||||||||..|.||:
Zfish   662 RGLVKVLFATETFAMGVNMPARTVVFDSIRKHDGTGFRNLLPGEYIQMAGRAGRRGLDATGTVII 726

  Fly   554 MIDEKVSPAVG--RDIVQGKADPINSAFHLTYNMVLNLLRVEEINPEYMLERSFYQFQNQAALPG 616
            :....|.. :|  ..::.||...::|.|.|||.|:|||||||.:....|::|||  .:|......
Zfish   727 LCKAGVHD-MGELHSMMLGKPTVLHSQFRLTYTMILNLLRVEALRVTDMMKRSF--SENHRDTQA 788

  Fly   617 LHDQVEQKTLELNKLTIKDEH----NIASYHHIRSQLDQHGKQFRQWITKPQYLLPFLQPGRLVK 677
            ...::.:....|:.|...|..    ::.||:|..::|....:..:|.:.:....|..|..||:|.
Zfish   789 HEKRISELRNTLSSLPPLDTEGQLSDLLSYYHTITELHITTQSLQQAVLESVNGLKALSVGRVVI 853

  Fly   678 VAAGSQEYDWGIVLNFKKQDQSRKNPLKAEPSVTIDVLLHV----SEAAAKTGDTEPCKPNERGC 738
            |.........|::|.......:|          |...|:..    .|||:.....:...|.....
Zfish   854 VNNSQHHNSLGVILQVSSDAVNR----------TFTALIICEKGNEEAASDEQSNKVALPIYSKT 908

  Fly   739 MEVV--PVAHTL----ITQISSIRV----YFPNDLRSADNRRAVLKTIQEAKKRFPLGPP----- 788
            :.:.  |.:||:    :..||:|..    ..|..:....|:|        .:.||.|.||     
Zfish   909 LFIPEGPCSHTVQKLKLQDISAITTKALKVIPERIIDNYNKR--------LQPRFRLDPPGQAIS 965

  Fly   789 ------------------VLNPIDDMNIKDREFRDIVNTISQFEKRLEE-----HPLHKSPELER 830
                              ||:|::|:::|.   .|:|..:.: ::.|::     |.:| ||....
Zfish   966 TATQELLRLAEANMGGMTVLDPVNDLHLKG---VDVVEGVMR-QRVLQDSLKDFHCIH-SPTFSE 1025

  Fly   831 IHRRYQDKVTLQKQLQDLKAELKAARSLLQMDELKHRKRVLRRMGYCKPGDVIEFKGRVACELSS 895
            ...|.|:::::|::|..| ..|.:.:||..:.|...|.:||..:.|......::.||||||::||
Zfish  1026 QFTRVQERMSVQEELDKL-LFLVSDQSLTLLPEYHQRIKVLEALQYVDSSGAVQLKGRVACQISS 1089

  Fly   896 ADELLMTEMIFNGVFNDLTAPQAVALLSCFVCDEKSSESVKSATELSGPLRSMQDLARRIAKVST 960
             .|||:||::|....:.|...::.|||||.|..:.:.........|...:..:..:|:||..:..
Zfish  1090 -HELLLTELLFENTLSPLAPEESAALLSCLVFTQNTQIEPHITNTLQEGINQVLAVAQRIGDLQR 1153

  Fly   961 ECKLDLDADTYVDKFKPFLMDVVLAWCKGSSFLAVCKMTDIFEGSIIRCMRRLEELLRQMCQASK 1025
            :|.:...|:.:|.:||..|.:||..|.:|..|..:.::||:.||:|:||::||:|:|:::.||::
Zfish  1154 DCGIAQTAEDFVAQFKFGLTEVVYCWARGMPFAEIAQLTDVQEGTIVRCIQRLDEVLKEVRQAAR 1218

  Fly  1026 TIGNTDLENKFSEGIRLLKRDIVFAASLY 1054
            .:|::.|.:|.......::|||||.||||
Zfish  1219 IVGDSVLGSKMERASLAIRRDIVFTASLY 1247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mtr4NP_524929.1 Dob10 91..1055 CDD:226947 366/1027 (36%)
DEAD 154..299 CDD:278688 96/145 (66%)
HELICc 390..554 CDD:238034 84/173 (49%)
rRNA_proc-arch 600..853 CDD:289976 60/299 (20%)
DSHCT 881..1048 CDD:285374 55/167 (33%)
skiv2lXP_005170104.1 Dob10 299..1247 CDD:226947 363/1014 (36%)
DEAD 323..470 CDD:278688 98/147 (67%)
HELICc 632..717 CDD:197757 59/85 (69%)
rRNA_proc-arch 774..1048 CDD:289976 60/300 (20%)
DSHCT 1075..1241 CDD:285374 55/167 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4581
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D176060at2759
OrthoFinder 1 1.000 FOG0000864
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.