DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mtr4 and mtrex

Sequence 1:NP_524929.1 Gene:Mtr4 FlyBaseID:FBgn0001986 Length:1055 Species:Drosophila melanogaster
Sequence 2:NP_999933.1 Gene:mtrex ZFINID:ZDB-GENE-040426-2854 Length:1034 Species:Danio rerio

Alignment Length:1067 Identity:661/1068 (62%)
Similarity:814/1068 (76%) Gaps:54/1068 (5%)


  Fly     4 EELFDCFDEVTPSVPPPALNQEEKPSGSSASKKGNKRQADGTTASKEATSSKGAEGDDKGDVTEE 68
            ::||..|||........|..:....:|.:..|.| |.|.|..:..|.       :.||.|     
Zfish     7 DDLFSVFDEEQAGSSKKAAPKSAANAGKTPDKAG-KPQGDSASLRKR-------DADDDG----- 58

  Fly    69 PTKRL---KQEASTVAVDDDNNADDEPTRTLDIDDSATLEALRTRIVTHLLDAPKSCTHEVAAHP 130
            |.:.|   :|:..||:.::.|                 |..|..::.:..::..:.|||||....
Zfish    59 PDEMLLGKRQKLETVSAEEIN-----------------LSELMPKVKSEQVETVEGCTHEVVLPA 106

  Fly   131 DQEYIPLKPFSGVPAKEYPFVLDPFQRQAILCIDNSQSVLVSAHTSAGKTVVAEYAIAKSLAAKQ 195
            ::||.||||..|..||||||:||||||:|||||||:|||||||||||||||.||||||.:|..||
Zfish   107 NEEYTPLKPRVGKAAKEYPFILDPFQREAILCIDNNQSVLVSAHTSAGKTVCAEYAIALALREKQ 171

  Fly   196 RVIYTTPIKALSNQKFREFTDEFKDVGLVTGDVTINPSASCLIMTTEILRNMLYRGSEIMREVGW 260
            |||:|:|||||||||:||..:||:||||:||||||||:||||:|||||||:|||||||:||||.|
Zfish   172 RVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRGSEVMREVAW 236

  Fly   261 VVFDEIHYMRDKERGVVWEETLILLPDNVRYVFLSATIPNARQFAEWVCHLHKQPCHVVYTDYRP 325
            |:|||||||||.|||||||||:|||||||.:||||||:|||||||||:|||||||||||||||||
Zfish   237 VIFDEIHYMRDSERGVVWEETIILLPDNVHHVFLSATVPNARQFAEWICHLHKQPCHVVYTDYRP 301

  Fly   326 TPLQHYIFPAGGDGIHLIVDEKGQFKEDNFTTAMAVLANAGEAG-----KGDQKGRHGGIKGTNA 385
            ||||||||||||||:||:|||.|:|:||||.|||.||.:||:.|     |.|.|||.||.|    
Zfish   302 TPLQHYIFPAGGDGLHLVVDENGEFREDNFNTAMQVLRDAGDTGGNTGAKWDPKGRKGGTK---- 362

  Fly   386 GQTNIFKIVKMIMERNFAPVIIFSFSKKDCEIYAMQMAKLDFNTPDEKKLVDEVFNNAMDVLTEE 450
            |.:|:||||||||||||.||||||||||:||.||:|::||||||.:|||||:||||||.|.|::|
Zfish   363 GPSNVFKIVKMIMERNFQPVIIFSFSKKECEAYALQVSKLDFNTDEEKKLVEEVFNNATDCLSDE 427

  Fly   451 DRRLPQVENVLPLLRRGIGIHHGGLLPILKETIEILFGEGLIKALFATETFAMGLNMPARTVLFT 515
            |::|||||:|||||:||||||||||||||||||||||.|||:||||||||||||:||||||||||
Zfish   428 DKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLLKALFATETFAMGINMPARTVLFT 492

  Fly   516 APRKFDGKKFRWISSGEYIQMAGRAGRRGLDDKGIVILMIDEKVSPAVGRDIVQGKADPINSAFH 580
            :.||||||.||||||||||||:|||||||:|::||||.|:|||:|||||:.:::|.|||:|||||
Zfish   493 SARKFDGKDFRWISSGEYIQMSGRAGRRGMDERGIVIFMVDEKMSPAVGKQLLKGSADPLNSAFH 557

  Fly   581 LTYNMVLNLLRVEEINPEYMLERSFYQFQNQAALPGLHDQVEQKTLELNKLTIKDEHNIASYHHI 645
            ||||||||||||||||||||||:||||||:..|:||:.|::::...|.|.:.|..|.::.:|:.|
Zfish   558 LTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAVPGVVDRMKKLEEEYNAIRIPKEESVVTYYKI 622

  Fly   646 RSQLDQHGKQFRQWITKPQYLLPFLQPGRLVKVAAGSQEYDWGIVLNFKKQDQSRKNPLKA---- 706
            |.||.:.||:..::|.||:|.||||||||||||.....::.||:|:||:|     |:.:||    
Zfish   623 RQQLAKLGKEIEEFIHKPRYCLPFLQPGRLVKVKKEDLDFGWGVVVNFQK-----KSNVKAGGDL 682

  Fly   707 EPSVTIDVLLHVSEAAAKTGDTE---PCKPNERGCMEVVPVAHTLITQISSIRVYFPNDLRSADN 768
            :|...::||:|.|:.:.|...||   |..|.|:|.|:||||...|||.|||:|:|.|.|||..||
Zfish   683 DPLFVVEVLVHCSKDSVKNAATESARPAGPAEKGEMQVVPVILHLITSISSVRLYIPKDLRPYDN 747

  Fly   769 RRAVLKTIQEAKKRFPLGPPVLNPIDDMNIKDREFRDIVNTISQFEKRLEEHPLHKSPELERIHR 833
            |:::||:|||.:||||.|.|:|:|||||.|||...:.::..:..||.|:..||||..|.||.:::
Zfish   748 RQSMLKSIQEVQKRFPDGIPLLDPIDDMGIKDPALKKVIQKVEAFEHRMYTHPLHSDPNLEAVYK 812

  Fly   834 RYQDKVTLQKQLQDLKAELKAARSLLQMDELKHRKRVLRRMGYCKPGDVIEFKGRVACELSSADE 898
            ..:.|..:...::..|.|||.||::|||||||.|||||||:|:....||||.|||||||.||.||
Zfish   813 LCEKKALIAGDIKAAKRELKKARTVLQMDELKCRKRVLRRLGFATSSDVIEMKGRVACETSSGDE 877

  Fly   899 LLMTEMIFNGVFNDLTAPQAVALLSCFVCDEKSSESVKSATELSGPLRSMQDLARRIAKVSTECK 963
            ||:|||:|||:||||||.||.|||||||..|.::|..|...:|.||||.||:.|:||||||.|.|
Zfish   878 LLLTEMMFNGLFNDLTAEQATALLSCFVFQENANEMPKLTEQLGGPLRQMQECAKRIAKVSAEAK 942

  Fly   964 LDLDADTYVDKFKPFLMDVVLAWCKGSSFLAVCKMTDIFEGSIIRCMRRLEELLRQMCQASKTIG 1028
            |::|.|:|:::|:|.|||||..|..||||..:|||||:||||||||||||||||||||||:|.||
Zfish   943 LEVDEDSYLNQFRPHLMDVVYTWANGSSFSQICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIG 1007

  Fly  1029 NTDLENKFSEGIRLLKRDIVFAASLYL 1055
            ||:|||||:.||..:||||||||||||
Zfish  1008 NTELENKFATGITKIKRDIVFAASLYL 1034

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mtr4NP_524929.1 Dob10 91..1055 CDD:226947 638/976 (65%)
DEAD 154..299 CDD:278688 119/145 (82%)
HELICc 390..554 CDD:238034 135/164 (82%)
rRNA_proc-arch 600..853 CDD:289976 115/260 (44%)
DSHCT 881..1048 CDD:285374 116/167 (69%)
mtrexNP_999933.1 Dob10 15..1034 CDD:226947 656/1058 (62%)
DEAD 130..275 CDD:278688 119/145 (82%)
HELICc 433..521 CDD:197757 79/88 (90%)
rRNA_proc-arch 577..832 CDD:289976 115/260 (44%)
DSHCT 860..1027 CDD:285374 116/167 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C323868920
eggNOG 1 0.900 E1_COG4581
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6257
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D176060at2759
OrthoFinder 1 1.000 FOG0000864
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127259
Panther 1 1.100 LDO PTHR12131
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.