DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mtr4 and Mtrex

Sequence 1:NP_524929.1 Gene:Mtr4 FlyBaseID:FBgn0001986 Length:1055 Species:Drosophila melanogaster
Sequence 2:NP_001029265.1 Gene:Mtrex RGDID:1305984 Length:1042 Species:Rattus norvegicus

Alignment Length:1067 Identity:668/1068 (63%)
Similarity:820/1068 (77%) Gaps:46/1068 (4%)


  Fly     4 EELFDCF-DEVTPSVPPPALNQEEK-----PSGSSASKKGNKRQADGTTASKEATSSKGAEGDDK 62
            :|||..| |:.|.:.......::||     |.| .|.|.|  ::.|....|:.|:|     |.:|
  Rat     7 DELFSVFEDDSTTAAGTKKDKEKEKDKWKGPPG-PADKAG--KRLDTRLQSEPASS-----GKNK 63

  Fly    63 GDVTEEPTKRLKQEASTVAVDDDNNADDEP-----TRTLD-IDDSATLEALRTRIVTHLLDAPKS 121
            .|:..|.|                   |||     .|..| |::..:|..|..|:....::..:.
  Rat    64 RDLDVEGT-------------------DEPIFGKKPRIEDSINEDLSLADLMPRVKVQSVETVEG 109

  Fly   122 CTHEVAAHPDQEYIPLKPFSGVPAKEYPFVLDPFQRQAILCIDNSQSVLVSAHTSAGKTVVAEYA 186
            ||||||...|::||||||..|..||||||:||.|||:||.|:||:|||||||||||||||.||||
  Rat   110 CTHEVALPADEDYIPLKPRVGKAAKEYPFILDAFQREAIQCVDNNQSVLVSAHTSAGKTVCAEYA 174

  Fly   187 IAKSLAAKQRVIYTTPIKALSNQKFREFTDEFKDVGLVTGDVTINPSASCLIMTTEILRNMLYRG 251
            ||.:|..|||||:|:|||||||||:||..:||:||||:||||||||:||||:|||||||:|||||
  Rat   175 IALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRG 239

  Fly   252 SEIMREVGWVVFDEIHYMRDKERGVVWEETLILLPDNVRYVFLSATIPNARQFAEWVCHLHKQPC 316
            ||:||||.||:|||||||||.|||||||||:|||||||.|||||||||||||||||:||||||||
  Rat   240 SEVMREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPC 304

  Fly   317 HVVYTDYRPTPLQHYIFPAGGDGIHLIVDEKGQFKEDNFTTAMAVLANAGEAGKGDQKGRHGGIK 381
            ||:||||||||||||||||||||:||:|||.|.|:||||.|||.||.:||:..|||||||.||.|
  Rat   305 HVIYTDYRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGDQKGRKGGTK 369

  Fly   382 GTNAGQTNIFKIVKMIMERNFAPVIIFSFSKKDCEIYAMQMAKLDFNTPDEKKLVDEVFNNAMDV 446
                |.:|:||||||||||||.|||||||||||||.||:||.||||||.:|||:|:||||||:|.
  Rat   370 ----GPSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMTKLDFNTDEEKKMVEEVFNNAIDC 430

  Fly   447 LTEEDRRLPQVENVLPLLRRGIGIHHGGLLPILKETIEILFGEGLIKALFATETFAMGLNMPART 511
            |::||::|||||:|||||:||||||||||||||||||||||.||||||||||||||||:||||||
  Rat   431 LSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLIKALFATETFAMGINMPART 495

  Fly   512 VLFTAPRKFDGKKFRWISSGEYIQMAGRAGRRGLDDKGIVILMIDEKVSPAVGRDIVQGKADPIN 576
            ||||..||:|||.||||||||||||:|||||||:||:||||||:|||:||.:|:.:::|.|||:|
  Rat   496 VLFTNARKYDGKDFRWISSGEYIQMSGRAGRRGMDDRGIVILMVDEKMSPTIGKQLLKGSADPLN 560

  Fly   577 SAFHLTYNMVLNLLRVEEINPEYMLERSFYQFQNQAALPGLHDQVEQKTLELNKLTIKDEHNIAS 641
            ||||||||||||||||||||||||||:||||||:..|:||:.::|:....:.||:.|.:|.|:..
  Rat   561 SAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPGVVEKVKNSEEQYNKIVIPNEENVVI 625

  Fly   642 YHHIRSQLDQHGKQFRQWITKPQYLLPFLQPGRLVKVAAGSQEYDWGIVLNFKKQDQSRKNPLKA 706
            |:.||.||.:.||:..::|.||:|.||||||||||||.....::.||:|:||.|:...:.|..:.
  Rat   626 YYKIRQQLAKLGKEIEEYIHKPKYCLPFLQPGRLVKVKNEGDDFGWGVVVNFSKKSNVKPNSGEL 690

  Fly   707 EPSVTIDVLLHVSEAAAKTGDTE---PCKPNERGCMEVVPVAHTLITQISSIRVYFPNDLRSADN 768
            :|...::|||..|:.:.|...||   |.||:|:|.|:||||...|::.||::|:|.|.|||..||
  Rat   691 DPLYVVEVLLRCSKESLKNSATEAAKPAKPDEKGEMQVVPVLVHLLSAISTVRLYIPKDLRPVDN 755

  Fly   769 RRAVLKTIQEAKKRFPLGPPVLNPIDDMNIKDREFRDIVNTISQFEKRLEEHPLHKSPELERIHR 833
            |::|||:|||.:||||.|.|:|:|||||.|:|:..:.::..:..||.|:..||||..|.||.::.
  Rat   756 RQSVLKSIQEVQKRFPDGVPLLDPIDDMGIQDQGLKKVIQKVEAFEHRMYSHPLHNDPNLETVYT 820

  Fly   834 RYQDKVTLQKQLQDLKAELKAARSLLQMDELKHRKRVLRRMGYCKPGDVIEFKGRVACELSSADE 898
            ..:.|..:...::..|.|||.||::|||||||.|||||||:|:....||||.|||||||:|||||
  Rat   821 LCEKKAQIAIDIKSAKRELKKARTVLQMDELKCRKRVLRRLGFATSSDVIEMKGRVACEISSADE 885

  Fly   899 LLMTEMIFNGVFNDLTAPQAVALLSCFVCDEKSSESVKSATELSGPLRSMQDLARRIAKVSTECK 963
            ||:|||:|||:||||::.||.|||||||..|.|||..|...:|:||||.||:.|:||||||.|.|
  Rat   886 LLLTEMMFNGLFNDLSSEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQECAKRIAKVSAEAK 950

  Fly   964 LDLDADTYVDKFKPFLMDVVLAWCKGSSFLAVCKMTDIFEGSIIRCMRRLEELLRQMCQASKTIG 1028
            |::|.:||:..|||.|||||..|..|::|..:|||||:||||||||||||||||||||||:|.||
  Rat   951 LEIDEETYLSSFKPHLMDVVYTWATGATFAHICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIG 1015

  Fly  1029 NTDLENKFSEGIRLLKRDIVFAASLYL 1055
            ||:|||||:|||..:||||||||||||
  Rat  1016 NTELENKFAEGITKIKRDIVFAASLYL 1042

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mtr4NP_524929.1 Dob10 91..1055 CDD:226947 644/973 (66%)
DEAD 154..299 CDD:278688 118/145 (81%)
HELICc 390..554 CDD:238034 138/164 (84%)
rRNA_proc-arch 600..853 CDD:289976 112/256 (44%)
DSHCT 881..1048 CDD:285374 117/167 (70%)
MtrexNP_001029265.1 Dob10 94..1042 CDD:226947 638/952 (67%)
DEAD 144..287 CDD:278688 117/143 (82%)
HELICc 374..538 CDD:238034 138/164 (84%)
rRNA_proc-arch 584..840 CDD:289976 112/256 (44%)
DSHCT 868..1035 CDD:285374 117/167 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C323867169
eggNOG 1 0.900 E1_COG4581
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6257
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D176060at2759
OrthoFinder 1 1.000 FOG0000864
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12131
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.