DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mtr4 and mtr4

Sequence 1:NP_524929.1 Gene:Mtr4 FlyBaseID:FBgn0001986 Length:1055 Species:Drosophila melanogaster
Sequence 2:NP_001342839.1 Gene:mtr4 PomBaseID:SPAC6F12.16c Length:1117 Species:Schizosaccharomyces pombe

Alignment Length:1128 Identity:583/1129 (52%)
Similarity:757/1129 (67%) Gaps:92/1129 (8%)


  Fly     5 ELFDCFDEVTPSVPPPALNQEEKPSGSSASKKGNKRQADGTTASKEATSSKGAEGDDKGDVTEEP 69
            ||.|.|......| |.:|.:|.|.|.:|.:.:..||......||.:...:|..| ...|: .|..
pombe     5 ELDDAFGVFEGKV-PKSLKEESKNSQNSQNSQKIKRTLTDKNASNQEQGTKKLE-SSVGE-QESA 66

  Fly    70 TKRLKQE------------------------AST--------VAVDD-------DNNADDEPTRT 95
            |||.|.|                        |.|        :|.||       .|..|..|..|
pombe    67 TKRAKIENLKDNQDLIPNNDVNGIHINNSAVADTKHKPKIGDIAADDISNEVSIKNEGDTIPEAT 131

  Fly    96 LDIDDSATLEA-LRTRIVTHLLDAPKSCT-----------HEVAAHPDQEYIPLKPFSG--VPAK 146
              :.||...|| |:......:.:| ||.|           |:|:..|:.:|:|:.....  .||:
pombe   132 --VADSFEQEASLQVAGKVGMTEA-KSSTEEVVELRHQVRHQVSIPPNYDYVPISKHKSPIPPAR 193

  Fly   147 EYPFVLDPFQRQAILCIDNSQSVLVSAHTSAGKTVVAEYAIAKSLAAKQRVIYTTPIKALSNQKF 211
            .|||.|||||..:|.||:..:|||||||||||||||||||:|:||..|||||||:|||||||||:
pombe   194 TYPFTLDPFQAVSIACIERQESVLVSAHTSAGKTVVAEYAVAQSLRDKQRVIYTSPIKALSNQKY 258

  Fly   212 REFTDEFKDVGLVTGDVTINPSASCLIMTTEILRNMLYRGSEIMREVGWVVFDEIHYMRDKERGV 276
            ||...||.||||:||||||||.|:||:|||||||:|||||||:||||.||:||||||||||||||
pombe   259 RELLAEFGDVGLMTGDVTINPDATCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDKERGV 323

  Fly   277 VWEETLILLPDNVRYVFLSATIPNARQFAEWVCHLHKQPCHVVYTDYRPTPLQHYIFPAGGDGIH 341
            |||||:|||||...:||||||||||.|||||:..:|:|||||||||:||||||||:||:|.||||
pombe   324 VWEETIILLPDKSHFVFLSATIPNAMQFAEWITKIHRQPCHVVYTDFRPTPLQHYLFPSGSDGIH 388

  Fly   342 LIVDEKGQFKEDNFTTAM-----------AVLANAGEAGKGDQKGRHGGIKGTNAGQTNIFKIVK 395
            |:||||..|:|:||..||           |.:|..|.|.||  |...||:|    |.::|:||||
pombe   389 LVVDEKSNFREENFQRAMSALMEKQGDDPAAMATKGNAKKG--KTGKGGVK----GPSDIYKIVK 447

  Fly   396 MIMERNFAPVIIFSFSKKDCEIYAMQMAKLDFNTPDEKKLVDEVFNNAMDVLTEEDRRLPQVENV 460
            |||.:|:.|||:|||||::||..|:||:|||.|...|:.||..:||||::.|:|:||.|||:|::
pombe   448 MIMVKNYNPVIVFSFSKRECEALALQMSKLDMNDQTERDLVTTIFNNAVNQLSEKDRELPQIEHI 512

  Fly   461 LPLLRRGIGIHHGGLLPILKETIEILFGEGLIKALFATETFAMGLNMPARTVLFTAPRKFDGKKF 525
            ||||||||||||.||||||||.|||||.|||:|.|||||||::||||||:||:||..||||||.|
pombe   513 LPLLRRGIGIHHSGLLPILKEVIEILFQEGLLKVLFATETFSIGLNMPAKTVVFTNVRKFDGKTF 577

  Fly   526 RWISSGEYIQMAGRAGRRGLDDKGIVILMIDEKVSPAVGRDIVQGKADPINSAFHLTYNMVLNLL 590
            ||||.||||||:||||||||||:||||||||||:.|.|.:.:::|:||.::|||||:|||:||||
pombe   578 RWISGGEYIQMSGRAGRRGLDDRGIVILMIDEKMDPPVAKSMLKGEADRLDSAFHLSYNMILNLL 642

  Fly   591 RVEEINPEYMLERSFYQFQNQAALPGLHDQVEQKTLELNKLTIKDEHNIASYHHIRSQLDQHGKQ 655
            |||.|:||:||||.|:||||...:|.|..::|:.....:..||.||..:..||.:::||:::...
pombe   643 RVEGISPEFMLERCFFQFQNSLEVPKLEAKLEESQQHYDSFTILDERPLEEYHTLKTQLERYRTD 707

  Fly   656 FRQWITKPQYLLPFLQPGRLVKVAAGSQEYDWGIVLNFKKQ--DQSRKNPLKAEPSVTIDVLLHV 718
            .|..:..|.:.|.|||.||||:|..|::::|||:|:|..|:  .:.:.|....:.|..:..|:.|
pombe   708 VRTVVNHPNFCLSFLQGGRLVRVKVGNEDFDWGVVVNVSKRPLPKGQSNEYLPQESYIVHTLVMV 772

  Fly   719 SEAAAKTG----------DTEPCKPNERGCMEVVPVAHTLITQISSIRVYFPNDLRSADNRRAVL 773
               |:.||          :..|....::|..||||...:.:..|:.|||:.||||:|...:..|.
pombe   773 ---ASDTGPLRIRSGHLPEVHPPAAEDKGKFEVVPFLLSSLDGIAHIRVFLPNDLKSQGQKLTVG 834

  Fly   774 KTIQEAKKRFPLGPPVLNPIDDMNIKDREFRDIVNTISQFEKRLEEHPLHKSPELERIHRRYQDK 838
            |.:.|.|:|||.|..:|:|:::||||:..|..::..::..|.||..:|||...|||..:..|..|
pombe   835 KALSEVKRRFPEGITLLDPVENMNIKEPTFIKLMKKVNILESRLLSNPLHNFSELEEKYAEYLRK 899

  Fly   839 VTLQKQLQDLKAELKAARSLLQMDELKHRKRVLRRMGYCKPGDVIEFKGRVACELSSADELLMTE 903
            :.|.::::|||.:|..|||::|:|||..|||||||:|:....||||.|||||||:||.|.||:||
pombe   900 LALLEEVKDLKKKLSKARSIMQLDELNSRKRVLRRLGFTTSDDVIEVKGRVACEISSGDGLLLTE 964

  Fly   904 MIFNGVFNDLTAPQAVALLSCFVCDEKSS-ESVKSATELSGPLRSMQDLARRIAKVSTECKLDLD 967
            :||||:|||||..|..|||||.|..|||. |:.:...||:|||:.:|::||||||||.|.|.:|:
pombe   965 LIFNGMFNDLTPEQCAALLSCLVFQEKSEVENQRMKEELAGPLKILQEMARRIAKVSKESKQELN 1029

  Fly   968 ADTYVDKFKPFLMDVVLAWCKGSSFLAVCKMTDIFEGSIIRCMRRLEELLRQMCQASKTIGNTDL 1032
            .:.||:.|||.||:||.||..|:||..:|||||::|||:||..||||||:|||..|:|.||||.|
pombe  1030 EEEYVNSFKPSLMEVVYAWAHGASFAQICKMTDVYEGSLIRMFRRLEELIRQMVDAAKVIGNTSL 1094

  Fly  1033 ENKFSEGIRLLKRDIVFAASLYL 1055
            :.|..:.|..:.|||||:|||||
pombe  1095 QQKMEDTIACIHRDIVFSASLYL 1117

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mtr4NP_524929.1 Dob10 91..1055 CDD:226947 551/1002 (55%)
DEAD 154..299 CDD:278688 114/145 (79%)
HELICc 390..554 CDD:238034 119/164 (73%)
rRNA_proc-arch 600..853 CDD:289976 91/265 (34%)
DSHCT 881..1048 CDD:285374 100/168 (60%)
mtr4NP_001342839.1 Dob10 52..1117 CDD:226947 567/1079 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6257
Inparanoid 1 1.050 1073 1.000 Inparanoid score I26
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000864
OrthoInspector 1 1.000 T1126020
orthoMCL 1 0.900 OOG5_127259
Panther 1 1.100 LDO PTHR12131
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R764
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.