DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mtr4 and Ddx60

Sequence 1:NP_524929.1 Gene:Mtr4 FlyBaseID:FBgn0001986 Length:1055 Species:Drosophila melanogaster
Sequence 2:NP_001280712.1 Gene:Ddx60 MGIID:2384570 Length:1710 Species:Mus musculus

Alignment Length:1115 Identity:210/1116 (19%)
Similarity:380/1116 (34%) Gaps:402/1116 (36%)


  Fly    71 KRLKQEASTVAVDDDNNADDEPTRTLDI-------------DDSATLEALRTRIVTHLLDAPKSC 122
            :|:..:|...|..:...|:.|.|:.|.|             ..|..|:....:::...|.....|
Mouse   639 ERVGLQACLKAWKEHCQAEGETTKDLSIAVNMMKRIHSLLDKHSELLQEADQKLIARCLKYLGFC 703

  Fly   123 THEVAAHPDQEY---IPLKPFS----GV-PAK---EY------------------PFVLDPFQRQ 158
            ...|:.:|.|:.   |.:|..:    |: ||:   :|                  .|:.|.:||:
Mouse   704 ELAVSLYPTQDASDGIKMKKKNKYSVGIGPARFQLQYMGHYLIREERKDPDPRVQDFIPDTWQRE 768

  Fly   159 AILCIDNSQSVLVSAHTSAGKTVVAEYAIAKSLAAKQR--VIYTTPIKALSNQKFREFTDEFKDV 221
            .:..:||.:|.::.|.||:|||..:.|.:.|.|.....  |:|..|.|||.||.  ..|.|::..
Mouse   769 LLDVVDNYESAVIVAPTSSGKTYASYYCMEKVLKESDEGVVVYVAPTKALVNQV--AATVEYRYA 831

  Fly   222 ----------GLVTGDVTINPSASCLIMTT-----EILRNMLYRGSEIMREVGWVVFDEIHYMRD 271
                      |:.|.|.. :.:.:|.::.|     |||....:|.:.:.| :.:|:|||:|.:..
Mouse   832 KNMPAGESLCGVFTRDYR-HDALNCQVLITVPACFEILLLAPHRQNWVKR-IRYVIFDEVHCLGG 894

  Fly   272 KERGVVWEETLILLPDNVRYVFLSATIPNARQFAEW----------------------------- 307
            :....:||..|:::  ...::.|||||.|.:...||                             
Mouse   895 EIGAEIWEHLLVMI--RCPFLALSATISNPQHLTEWLQSVKRYWKQVDSTMEERTVSKRTGTSRG 957

  Fly   308 --------------------------------------VCHLHKQPCHVVYTDYRPTPLQHYIFP 334
                                                  ||..|..||..:..|:    ::.|.||
Mouse   958 SYYKDQAQARQSYKVRLVLYGERYNDLEKYLCSVRQGDVCFDHFHPCAALTIDH----IEKYGFP 1018

  Fly   335 AGGDGIHLIVDEKGQFKE-----------------DNFTT-AMAVLANAGEAGKGDQKGRH---G 378
            :   .:.|...|..|..:                 :|||. ...::....:|.|.::..:.   .
Mouse  1019 S---DLALSPRESIQLYDTMCQVWKSWPQAQSLCPENFTQFKNKIVIKKLDARKYEESLKEEFTN 1080

  Fly   379 GIKGTNAGQTN-IFK-------------------IVKMIMERNFAPVIIFSF------------- 410
            .:|..|..:.. :.|                   :|:.:.:....|.:.|.|             
Mouse  1081 WVKNGNEEEARMVLKKLSPDYHEHSGRMLDFFPCLVEKLRKMEKLPALFFLFKLNIVEECAENAF 1145

  Fly   411 --------------SKKDCEIYAMQMAKLDFNTPDEKKLVDEVFNNAMDVLTE------------ 449
                          :.|:....|.::.|:. .:.:::|.|||....:...|.|            
Mouse  1146 EFLEKKQEEKRPPKADKEARTTANKLRKVK-KSLEKQKTVDEKGQKSSRRLDESVMHETEHNYLL 1209

  Fly   450 ---------------------EDRRLPQV----------ENVLPLLRRGIGIHHGGLLPILKETI 483
                                 :|:.|.:|          |.:..|..||||.||..:....|:.:
Mouse  1210 QTLEKNLEIPKDCTYANQKAIDDQLLQRVFHRVRFERKGETLKRLAERGIGYHHSSMSAKEKQLV 1274

  Fly   484 EILFGEGLIKALFATETFAMGLNMPARTVLFTAPRKFDGKKFRWISSGEYIQMAGRAGRRGLDDK 548
            ||||.:|.|:.:.||.|.|:|:|||.::|:|       .:...::.:..|.||:|||||||.|..
Mouse  1275 EILFRKGFIRVVTATGTLALGINMPCKSVVF-------AQNSVYLDALNYRQMSGRAGRRGQDLL 1332

  Fly   549 GIVILMIDEKVSPAVGRDIVQGKADPINSAFHLTYNMVLNLL----RVEEINPE-----YMLERS 604
            |.|...  :...|.:|: :::.|...:...|.|:.:::|.|:    :.:::...     .:|:.|
Mouse  1333 GDVYFF--DIPLPKIGK-LIKSKVPELRGQFPLSISLILRLMLLASKADDLEDGKAKALSVLKHS 1394

  Fly   605 FYQFQNQAALPGLHDQVEQKTLELNKLTIKDEHNIASYHHIRSQLDQHGKQ--FRQWITKPQYLL 667
            ...|:...|:    |.::...|...:..:|:.|           :||.|..  |...::.    |
Mouse  1395 LLSFKQPRAI----DMLKLYFLYSLQFLVKEGH-----------IDQEGNPTGFAGLVSH----L 1440

  Fly   668 PFLQPGRLVKVAAGSQEYDWGIVLNFKKQDQSRKNPLKAEPSVTIDVLLHVSEAAAKTGDTEPCK 732
            .:.:|..||.|                              |..:..|.|           :.|:
Mouse  1441 HYHEPSNLVFV------------------------------SFLVKGLFH-----------KLCQ 1464

  Fly   733 PNERGCMEVVP------VAHTLITQISSI--RVYFPNDLRSADNRRAVLKTIQEAKKRFPLGPPV 789
            |...|     |      |...|:..::::  |.|.|......:::....|..             
Mouse  1465 PTREG-----PKRFSEDVMEKLVLVLANLFGRRYIPAKFYEVNSKFYQSKVF------------- 1511

  Fly   790 LNPIDDMNIKDREFRDIVNTISQFEKRLEEHPLHKSPELERIHRRYQDKVTLQKQLQDLKAELKA 854
               :||:.      .|..:.:.::..::.|.              :...:.:..:|.|:|.|.:.
Mouse  1512 ---LDDLP------EDFSHALLEYNTQVTED--------------FASFLLMVSRLADMKQEYQL 1553

  Fly   855 ARSLLQM--DELKHRKRVLRRMGYCKPGDVIEFKGRVA-----CELSSADELLMTEMIFNGV--- 909
            :.|.::.  .|.:....|...|. ||       :||||     |...:.|..|::..:.|.|   
Mouse  1554 SLSKIEFTGKECEDSPLVSHLMN-CK-------EGRVAVSPFVCLSGNFDVDLLSPGVPNHVILH 1610

  Fly   910 ---FNDLTAP 916
               .|...||
Mouse  1611 TLGINHTQAP 1620

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mtr4NP_524929.1 Dob10 91..1055 CDD:226947 206/1096 (19%)
DEAD 154..299 CDD:278688 47/162 (29%)
HELICc 390..554 CDD:238034 55/253 (22%)
rRNA_proc-arch 600..853 CDD:289976 38/263 (14%)
DSHCT 881..1048 CDD:285374 12/48 (25%)
Ddx60NP_001280712.1 DEXDc 760..951 CDD:214692 52/197 (26%)
DEAD 766..920 CDD:278688 47/160 (29%)
HELICc 1252..1328 CDD:197757 33/83 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4581
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.