DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mtr4 and skih-2

Sequence 1:NP_524929.1 Gene:Mtr4 FlyBaseID:FBgn0001986 Length:1055 Species:Drosophila melanogaster
Sequence 2:NP_502084.2 Gene:skih-2 WormBaseID:WBGene00008502 Length:1266 Species:Caenorhabditis elegans

Alignment Length:1173 Identity:379/1174 (32%)
Similarity:575/1174 (49%) Gaps:187/1174 (16%)


  Fly    11 DEVTPSVPPPALNQEEKPSGSSASKKGNKRQADGTTASKEATSSKGAEGDDKGDVTE-------- 67
            |:.|.....|.:.|...|:.||..|..            |...|...|..|..|:.:        
 Worm   149 DDATLLNTIPTIGQIVLPNHSSVKKPA------------ETPKSINIEEMDMFDLLDMVTSNEYI 201

  Fly    68 -----EPTKRLKQEASTVAVDDDNNADDEPTRTLDIDDSATLEALRTRIVTHLLDAPKSCTHE-- 125
                 .|.|:.:...|....:||....:.....::|    .:....|..|..:..|....|.|  
 Worm   202 IHTVAAPVKKSESIESEETPEDDKKVSENEIDEIEI----PIIPGNTEKVIEIFGAATEPTKEKF 262

  Fly   126 -------VAAHPDQEYIPLKPFSGVPAKEYPFVLDPFQRQAILCIDNSQSVLVSAHTSAGKTVVA 183
                   ::|..:.||..|.|   ..|::|||.|||||:.::||::..:|:.|:|||||||||||
 Worm   263 EFAQRLVLSADEEDEYKRLVP---TMARKYPFSLDPFQQSSVLCMERGESLFVAAHTSAGKTVVA 324

  Fly   184 EYAIAKSLAAKQRVIYTTPIKALSNQKFREFTDEFKDVGLVTGDVTINPSASCLIMTTEILRNML 248
            |||||...|.|.|.:||:|||||||||||:|...|.||||||||:.::|.|:||||||||||:||
 Worm   325 EYAIALCQAHKTRAVYTSPIKALSNQKFRDFKQIFGDVGLVTGDIQLHPEAACLIMTTEILRSML 389

  Fly   249 YRGSEIMREVGWVVFDEIHYMRDKERGVVWEETLILLPDNVRYVFLSATIPNARQFAEWVCHLHK 313
            |.|||::|::.||||||:||:.::|||.||||.||:||.:|:.|.||||:||..:||:||..:..
 Worm   390 YNGSEVIRDLEWVVFDEVHYINNEERGHVWEEVLIMLPAHVKIVMLSATVPNCVEFADWVGRIKN 454

  Fly   314 QPCHVVYTDYRPTPLQHYIFPAGGDG-----IHLIVDEKGQFKEDNFTTAMAVLAN-------AG 366
            :..:|:.||.||.||:|::: .|.||     :..|:|..|||....:..|....|.       .|
 Worm   455 RKINVISTDRRPVPLEHFLY-TGQDGKTQKDLFKIIDRSGQFILKGYNDAKDSKAKIYEKEKAGG 518

  Fly   367 EAGKGDQKGRHGGIKGTNAGQT-------NIF-KIVKMIMERNFAPVIIFSFSKKDCEIYAMQMA 423
            ..|:|.|:|...|..|...|:.       ||: .::..:...:..|:::|.||:|.|:..|..:|
 Worm   519 AGGRGTQRGGGRGGGGNGGGRNWPGKNDKNIYLNLINYMKCSDQLPMVVFVFSRKRCDENAQMLA 583

  Fly   424 KLDFNTPDEKKLVDEVFNNAMDVLTEEDRRLPQVENVLPLLRRGIGIHHGGLLPILKETIEILFG 488
            .::..|..||:.|...|:..:..|...|:.||||..:..|..||..:||.|:||||||.:|:||.
 Worm   584 SMNLTTEVEKQHVRLFFSQCVQRLKGSDKELPQVLTMRDLCLRGFAVHHSGILPILKEVVELLFQ 648

  Fly   489 EGLIKALFATETFAMGLNMPARTVLFTAPRKFDGKKFRWISSGEYIQMAGRAGRRGLDDKGIVIL 553
            :|.:|.||||||||||:|||||.|:|.:..|.||.:.|.::.|||.||||||||||||..|.||:
 Worm   649 KGYVKILFATETFAMGVNMPARCVVFDSIMKHDGTERRMLNPGEYTQMAGRAGRRGLDLTGTVII 713

  Fly   554 MIDEKV--SPAVGRDIVQGKADPINSAFHLTYNMVLNLLRVEEINPEYMLERSFYQFQNQAALPG 616
            :..:..  .|.|.::::.|:|..:.|.|.:||:|:|||||||::..|.||:||:.:..:      
 Worm   714 ICKDSTVPQPDVLKNLISGQALRLESKFRVTYSMILNLLRVEQLKIEDMLQRSYVESDS------ 772

  Fly   617 LHDQVE-QKTLELNKLTIKDEHNI-ASYHHIRSQLDQHGKQFRQWITKPQYLLP----------F 669
            |.:..| :|:|...|..|:....| .|.....|||..:......::.|.:::.|          .
 Worm   773 LRESKEKRKSLVDTKNAIQTMSTIECSTCSPNSQLRDYHDALAVFLRKSEHIWPKLNDENVINKL 837

  Fly   670 LQPGRLVKVAAGSQEYDWGIVLNFKK---------------QDQSRKNPL--------KAEPSVT 711
            |..||.:.|.:..|:.....||..|:               .:.:.||..        |:|.|..
 Worm   838 LCSGRFLIVNSAQQQLQNECVLLIKELNNKTLQILVASADADETTNKNAAAIGFSKLPKSELSWL 902

  Fly   712 IDVLLHVSEAAAKTGDTEPCKPNERG-----------------CMEVVPVAHTL----ITQISSI 755
            .:....:|.:...|.....|..|.|.                 |.:.|.....|    :|||...
 Worm   903 TEENSLLSTSKFGTRGAAHCSTNIRSFRLCEIPLSGIVAVMKKCAKGVQSGEILQEYNMTQIPRF 967

  Fly   756 RVYFPNDLRSADNRRAVLKTIQEAKKRFPLGPPVLNPIDDMNIK---------DREF-RDIVNTI 810
            |     |...::|.:.:|:.|..|......|     .|:....|         |..| .|::..:
 Worm   968 R-----DRELSENVKKLLQQITTAVPGLKSG-----EIETYTWKELGSFCQNLDTSFDTDLLEKL 1022

  Fly   811 SQFEKRLEEHPLHKSPELERIHRRYQDKVTLQKQLQDLKAELKAARSLLQMDELKHRKRVLRRMG 875
            .......:..|.......:......:|::.::::::.|:.|| ::.:||..:|..:|.:||..:.
 Worm  1023 EYNLNLPQSFPARHCTRFDEHFSVLRDRIRIERKIESLEYEL-SSDALLLSEEYHNRLKVLEALN 1086

  Fly   876 YCKPGDVIEFKGRVACELSSADELLMTEMIFNGVFNDLTAPQAVALLSCFVCDEKS--------- 931
            :.:. .::..|||:.||:.. .|||:||:|.:..|:..:..:..||||...|...|         
 Worm  1087 FVEQ-KMVSLKGRIGCEIHH-QELLITELILDYKFHQRSPAELAALLSTLTCQYNSGREMQFGGD 1149

  Fly   932 ------SESVKSATELSGPLRSMQDLARR----IAKVSTECKLDLDADTYVDKFKPFLMDVVLAW 986
                  ||||||.      |..::.:|.:    |:.:..|.:.|             ||:||..|
 Worm  1150 TVFGEISESVKSV------LTRLESVASKHKSQISDLGCEIRFD-------------LMEVVYEW 1195

  Fly   987 CKGSSFLAVCKMTDIFEGSIIRCMRRLEELLRQMCQASKTIGNTDLENKFSEGIRLLKRDIVFAA 1051
            ..|:.|..:.:|||..||.|::|::||:|:.:.:..|.:.:|:..|..|..|....::|||||||
 Worm  1196 ANGTPFYQIMEMTDCQEGLIVKCIQRLDEVCKDVRNAGRIVGDPALVEKMEEVSASIRRDIVFAA 1260

  Fly  1052 SLY 1054
            |||
 Worm  1261 SLY 1263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mtr4NP_524929.1 Dob10 91..1055 CDD:226947 361/1081 (33%)
DEAD 154..299 CDD:278688 93/145 (64%)
HELICc 390..554 CDD:238034 76/165 (46%)
rRNA_proc-arch 600..853 CDD:289976 58/319 (18%)
DSHCT 881..1048 CDD:285374 54/186 (29%)
skih-2NP_502084.2 DEXDc 287..472 CDD:214692 112/185 (61%)
DEAD 295..440 CDD:278688 93/145 (64%)
HELICc 612..704 CDD:197757 54/92 (59%)
KOW <1017..1065 CDD:294253 6/49 (12%)
DSHCT 1093..1257 CDD:285374 54/184 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4581
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D176060at2759
OrthoFinder 1 1.000 FOG0000864
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.