DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mtr4 and mtr-4

Sequence 1:NP_524929.1 Gene:Mtr4 FlyBaseID:FBgn0001986 Length:1055 Species:Drosophila melanogaster
Sequence 2:NP_501757.1 Gene:mtr-4 WormBaseID:WBGene00012342 Length:1026 Species:Caenorhabditis elegans

Alignment Length:1071 Identity:518/1072 (48%)
Similarity:696/1072 (65%) Gaps:70/1072 (7%)


  Fly     8 DCFDE-VTPSVPPPALNQEEKPSGSSAS-KKGNKRQADGTTASKEATSSKGAEGDDKGDVTEEPT 70
            |.||| :.|.|....::.||.|...... ....||||                       .|:.|
 Worm     3 DLFDEFIEPGVKNEIMDVEEAPENPMEKLDSAKKRQA-----------------------REDMT 44

  Fly    71 KRLKQEASTVAVDDDNNADDEPTRTLDIDDSATLEALR-TRIVTHLLDAP-KSCTHEVAAHPDQE 133
            ..|....:.|.|   .|.|:..::...:::...:|..| ..|:.|.:... ::||||||..|:.|
 Worm    45 NLLANMHNDVGV---GNFDEATSKRARVEEEEEVEEARMENIIVHTIRTDNENCTHEVAIPPNAE 106

  Fly   134 YIPLKPFSGV-PAKEYPFVLDPFQRQAILCIDNSQSVLVSAHTSAGKTVVAEYAIAKSLAAKQRV 197
            :..|:..||. |||.|||.||.||:||||||||:|||||||||||||||||.|||||.|..||||
 Worm   107 FAELRENSGTEPAKYYPFQLDAFQKQAILCIDNNQSVLVSAHTSAGKTVVATYAIAKCLREKQRV 171

  Fly   198 IYTTPIKALSNQKFREFTDEFKDVGLVTGDVTINPSASCLIMTTEILRNMLYRGSEIMREVGWVV 262
            |||:|||||||||:||..:|||||||:|||||:||.||||:|||||||:|||||||||:||||||
 Worm   172 IYTSPIKALSNQKYRELEEEFKDVGLMTGDVTLNPDASCLVMTTEILRSMLYRGSEIMKEVGWVV 236

  Fly   263 FDEIHYMRDKERGVVWEETLILLPDNVRYVFLSATIPNARQFAEWVCHLHKQPCHVVYTDYRPTP 327
            :||||||||||||||||||:||:..|::..|||||||||||||:||..:.:||.:||||||||||
 Worm   237 YDEIHYMRDKERGVVWEETIILMSKNIKQAFLSATIPNARQFAQWVASIKQQPVNVVYTDYRPTP 301

  Fly   328 LQHYIFPAGGDGIHLIVDEKGQFKEDNFTTAMAVLANAGEAGKGDQKGRHGGIKGTNAGQTNIFK 392
            |||:|:|.||:|::.:|:.||:|:||.|..||:.||.||::.....|.|.||  ||. |.:|:.|
 Worm   302 LQHWIYPVGGEGMYEVVNVKGEFREDKFRDAMSGLATAGDSAGSFNKRRTGG--GTQ-GDSNVLK 363

  Fly   393 IVKMIMERNFAPVIIFSFSKKDCEIYAMQMAKLDFNTPDEKKLVDEVFNNAMDVLTEEDRRLPQV 457
            |::.:...:....|:||||:|:||.||:.:..:|||...||.:|..|:.:|:..|:.||::|||:
 Worm   364 IIRSVASNDGLNCIVFSFSRKECESYAISLKDMDFNKDHEKGMVKSVYESAIAQLSPEDQKLPQI 428

  Fly   458 ENVLPLLRRGIGIHHGGLLPILKETIEILFGEGLIKALFATETFAMGLNMPARTVLFTAPRKFDG 522
            .|:|||||||||:||.||:|||||||||||||||:|.|||||||:||||||||||:||:.|||||
 Worm   429 LNILPLLRRGIGVHHSGLMPILKETIEILFGEGLVKVLFATETFSMGLNMPARTVVFTSARKFDG 493

  Fly   523 KKFRWISSGEYIQMAGRAGRRGLDDKGIVILMIDEKVSPAVGRDIVQGKADPINSAFHLTYNMVL 587
            ...|:|:|||||||||||||||.||:|.||||:|..:|....:.|::|..||:||.|.|||||||
 Worm   494 SDNRYITSGEYIQMAGRAGRRGKDDRGTVILMVDSAMSADDAKQIIKGATDPLNSQFRLTYNMVL 558

  Fly   588 NLLRVEEINPEYMLERSFYQFQNQAALPGLHDQVEQKTLELNKLTIKDEHNIASYH--------- 643
            ||:|||.:...:::..||:|||:.|.:|           |::|..::.|..|||::         
 Worm   559 NLMRVEGMAVSWIINNSFHQFQSYAKIP-----------EIDKKCVQVERKIASFNFPWENEMRT 612

  Fly   644 --HIRSQLDQHGKQFRQWITKPQYLLPFLQPGRLVKVAAGSQEYDWGIVLNFKKQDQSRKNPLKA 706
              .::.||:...::..|...:|:|::.||..|||.||.:|.:::.|||:..|||:    :||...
 Worm   613 LVDLQDQLEATRQRIIQIQREPKYIVGFLHAGRLFKVKSGDRDFKWGILNQFKKE----QNPDDR 673

  Fly   707 EPSVTIDVLLHVSEAAAKTGDTEPCK-------PNERGCMEVVPVAHTLITQISSIRVYFPNDLR 764
            ...:.:..::.......:...|.|..       |..|...  ||:....||.||::|:..|.|:.
 Worm   674 NDQIYLCDMMIAINTEGRFDPTNPATLVPGFDLPKRRWIR--VPMTIDRITAISAVRLKVPADID 736

  Fly   765 SADNRRAVLKTIQEAKKRFPLGPPVLNPIDDMNIKDREFRDIVNTISQFEKRLEEHPLHKSPELE 829
            ..|.:..:...:..|.|||....|:|:||.||.||..|.::::......|.|||.|.:.|...::
 Worm   737 KPDGQMRLDGMMAAATKRFGNQIPLLDPIQDMEIKTVEMKELIAREKSLEGRLETHSMTKRDNMK 801

  Fly   830 RIHRRYQDKVTLQKQLQDLKAELKAARSLLQMDELKHRKRVLRRMGYCKPGDVIEFKGRVACELS 894
            .:.::::.|....|:|..||||.|:.:|.|.::||.:|||||||:||....|.:..||.||||||
 Worm   802 DLKKQFEQKQDAVKELNALKAERKSVQSTLHLEELNNRKRVLRRLGYLGNDDALVLKGSVACELS 866

  Fly   895 SADELLMTEMIFNGVFNDLTAPQAVALLSCFVCDEKSSESVKSATELSGPLRSMQDLARRIAKVS 959
            ::|||::|||:..|:||.|...|..|||||||..:|.: :.|.||||...|..:.:.||.:||||
 Worm   867 ASDELILTEMLLKGIFNTLDVAQTAALLSCFVFQDKCA-APKLATELQTCLSELHEQARNVAKVS 930

  Fly   960 TECKLDLDADTYVDKFKPFLMDVVLAWCKGSSFLAVCKMTDIFEGSIIRCMRRLEELLRQMCQAS 1024
            .|||:::..|.||..|.|.|||||..|..|::|..:.|.||:|||||||.:|||||:||:|..|:
 Worm   931 NECKMEVMEDKYVSSFNPGLMDVVYQWVNGATFSEIVKTTDVFEGSIIRTLRRLEEVLREMINAA 995

  Fly  1025 KTIGNTDLENKFSEGIRLLKRDIVFAASLYL 1055
            |.:.|.:||.||.:..:.|||||||||||||
 Worm   996 KALANKELEQKFEDARKNLKRDIVFAASLYL 1026

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mtr4NP_524929.1 Dob10 91..1055 CDD:226947 497/985 (50%)
DEAD 154..299 CDD:278688 118/145 (81%)
HELICc 390..554 CDD:238034 103/164 (63%)
rRNA_proc-arch 600..853 CDD:289976 74/271 (27%)
DSHCT 881..1048 CDD:285374 86/167 (51%)
mtr-4NP_501757.1 Dob10 97..1026 CDD:226947 491/950 (52%)
DEAD 130..273 CDD:278688 117/143 (82%)
HELICc 427..515 CDD:197757 71/88 (81%)
rRNA_proc-arch 571..825 CDD:289976 74/271 (27%)
DSHCT 857..1019 CDD:285374 85/163 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C323875082
eggNOG 1 0.900 E1_COG4581
Hieranoid 1 1.000
Homologene 1 1.000 H6257
Inparanoid 1 1.050 949 1.000 Inparanoid score I166
Isobase 1 0.950 0 Normalized mean entropy S388
OMA 1 1.010
OrthoDB 1 1.010 D176060at2759
OrthoFinder 1 1.000 FOG0000864
OrthoInspector 1 1.000 T477277
orthoMCL 1 0.900 OOG5_127259
Panther 1 1.100 LDO PTHR12131
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R764
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.