DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mtr4 and mtrex

Sequence 1:NP_524929.1 Gene:Mtr4 FlyBaseID:FBgn0001986 Length:1055 Species:Drosophila melanogaster
Sequence 2:XP_002941157.1 Gene:mtrex XenbaseID:XB-GENE-1013876 Length:1031 Species:Xenopus tropicalis

Alignment Length:1056 Identity:668/1057 (63%)
Similarity:817/1057 (77%) Gaps:35/1057 (3%)


  Fly     4 EELFDCFDEVTPSVPPPALNQEEKPSGSSASKKGNKRQADGTTASKEATSSKGAEGDDKGDVTEE 68
            :|||..|:|.||:....||        .:|:.|..||.|          .||||...        
 Frog     7 DELFSVFEEETPATSKSAL--------PAAAGKTGKRNA----------KSKGAGAG-------- 45

  Fly    69 PTKRLKQEASTVAVDDDNNADDEPTRTLDIDDSATLEALRTRIVTHLLDAPKSCTHEVAAHPDQE 133
            |..:.|:||..:...|:.....:|...:...|...|..|..||....::..:.||||||...|:|
 Frog    46 PAPKAKREADCIDGPDEVVFGKKPKLEISSADDINLADLMPRIKVQEVETVEGCTHEVALPADEE 110

  Fly   134 YIPLKPFSGVPAKEYPFVLDPFQRQAILCIDNSQSVLVSAHTSAGKTVVAEYAIAKSLAAKQRVI 198
            |:||||..|..|||||||||.|||:|||||||:|||||||||||||||.|||:||.:|..|||||
 Frog   111 YVPLKPRVGKAAKEYPFVLDAFQREAILCIDNNQSVLVSAHTSAGKTVCAEYSIALALREKQRVI 175

  Fly   199 YTTPIKALSNQKFREFTDEFKDVGLVTGDVTINPSASCLIMTTEILRNMLYRGSEIMREVGWVVF 263
            :|:|||||||||:||..:||:||||:||||||||:||||:|||||||:|||||||:||||.||:|
 Frog   176 FTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRGSEVMREVAWVIF 240

  Fly   264 DEIHYMRDKERGVVWEETLILLPDNVRYVFLSATIPNARQFAEWVCHLHKQPCHVVYTDYRPTPL 328
            ||||||||.|||||||||:|||||||.|||||||||||||||||:||||||||||:|||||||||
 Frog   241 DEIHYMRDAERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPCHVIYTDYRPTPL 305

  Fly   329 QHYIFPAGGDGIHLIVDEKGQFKEDNFTTAMAVLANAGEAGKGDQKGRHGGIKGTNAGQTNIFKI 393
            ||||||:||||:||:|||.|.|:||||.|||.||.:||:..|||||||.||.|    |.:|:|||
 Frog   306 QHYIFPSGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGDQKGRKGGTK----GPSNVFKI 366

  Fly   394 VKMIMERNFAPVIIFSFSKKDCEIYAMQMAKLDFNTPDEKKLVDEVFNNAMDVLTEEDRRLPQVE 458
            |||||||||.|||||||||||||.||:||:||||||.:|||:|:||||||:|.|::||::|||||
 Frog   367 VKMIMERNFQPVIIFSFSKKDCEAYALQMSKLDFNTDEEKKMVEEVFNNAIDCLSDEDKKLPQVE 431

  Fly   459 NVLPLLRRGIGIHHGGLLPILKETIEILFGEGLIKALFATETFAMGLNMPARTVLFTAPRKFDGK 523
            :|||||:||||||||||||||||||||||.|||:||||||||||||:||||||||||:.||||||
 Frog   432 HVLPLLKRGIGIHHGGLLPILKETIEILFSEGLLKALFATETFAMGINMPARTVLFTSARKFDGK 496

  Fly   524 KFRWISSGEYIQMAGRAGRRGLDDKGIVILMIDEKVSPAVGRDIVQGKADPINSAFHLTYNMVLN 588
            .||||||||||||:|||||||:|::||||||:|||:||.||:.:::|.|||:|||||||||||||
 Frog   497 DFRWISSGEYIQMSGRAGRRGMDERGIVILMVDEKMSPTVGKQLLKGSADPLNSAFHLTYNMVLN 561

  Fly   589 LLRVEEINPEYMLERSFYQFQNQAALPGLHDQVEQKTLELNKLTIKDEHNIASYHHIRSQLDQHG 653
            ||||||||||||||:||||||:..|:||:.::|::...:.|.:.|.:|.|:.:|:.||.||.:.|
 Frog   562 LLRVEEINPEYMLEKSFYQFQHYRAIPGVAEKVKKLEEQYNSIQIPNEENVVTYYKIRQQLAKLG 626

  Fly   654 KQFRQWITKPQYLLPFLQPGRLVKVAAGSQEYDWGIVLNFKKQDQSRKNPLKAEPSVTIDVLLHV 718
            |:...:|.||:|.|||:||||||||.:...::.||.|:||.|:...:.|..:.:|...::||::.
 Frog   627 KEIEDYIHKPKYCLPFMQPGRLVKVKSEDDDFGWGAVVNFSKKSNVKPNSGELDPLYVVEVLINC 691

  Fly   719 SEAAAKTGDTE---PCKPNERGCMEVVPV-AHTLITQISSIRVYFPNDLRSADNRRAVLKTIQEA 779
            |:.:.|...||   |.:|:|||.|:|||| .|||.. |||:|:|.|.|||:.|||::|||:|||.
 Frog   692 SKESVKNAATEAAKPARPDERGEMQVVPVMLHTLCA-ISSVRLYIPKDLRTTDNRQSVLKSIQEV 755

  Fly   780 KKRFPLGPPVLNPIDDMNIKDREFRDIVNTISQFEKRLEEHPLHKSPELERIHRRYQDKVTLQKQ 844
            :||||.|.|:|:|||||.|||...:.:|.....||.|:..|||:..|.||.:::..:.|..:...
 Frog   756 QKRFPDGVPLLDPIDDMGIKDPGLKKVVQKTEAFEHRMYSHPLNNDPNLESLYKLCEKKAQIAVD 820

  Fly   845 LQDLKAELKAARSLLQMDELKHRKRVLRRMGYCKPGDVIEFKGRVACELSSADELLMTEMIFNGV 909
            ::..|.|||.||::|||||||.|||||||:|:....||||.|||||||:|||||||:|||:|||:
 Frog   821 IRAAKRELKKARTVLQMDELKCRKRVLRRLGFATASDVIEMKGRVACEISSADELLLTEMMFNGL 885

  Fly   910 FNDLTAPQAVALLSCFVCDEKSSESVKSATELSGPLRSMQDLARRIAKVSTECKLDLDADTYVDK 974
            ||||||.||.|||||||..|.|||..|...:|:||||.||:.||||||||.|.||::|.:||:..
 Frog   886 FNDLTAEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQETARRIAKVSAEAKLEVDEETYLGS 950

  Fly   975 FKPFLMDVVLAWCKGSSFLAVCKMTDIFEGSIIRCMRRLEELLRQMCQASKTIGNTDLENKFSEG 1039
            |:..||||:..|..|::|..:|||||:||||||||||||||||||||||:|.||||:|||||:||
 Frog   951 FRSNLMDVLYTWANGATFAQICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIGNTELENKFAEG 1015

  Fly  1040 IRLLKRDIVFAASLYL 1055
            |..:||||||||||||
 Frog  1016 ITKIKRDIVFAASLYL 1031

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mtr4NP_524929.1 Dob10 91..1055 CDD:226947 644/968 (67%)
DEAD 154..299 CDD:278688 119/145 (82%)
HELICc 390..554 CDD:238034 137/164 (84%)
rRNA_proc-arch 600..853 CDD:289976 113/257 (44%)
DSHCT 881..1048 CDD:285374 117/167 (70%)
mtrexXP_002941157.1 Dob10 101..1031 CDD:226947 636/935 (68%)
DEAD 133..276 CDD:278688 118/143 (83%)
HELICc 363..527 CDD:238034 137/164 (84%)
rRNA_proc-arch 573..829 CDD:289976 113/257 (44%)
DSHCT 857..1024 CDD:285374 117/167 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H6257
Inparanoid 1 1.050 1329 1.000 Inparanoid score I128
OMA 1 1.010
OrthoDB 1 1.010 D176060at2759
OrthoFinder 1 1.000 FOG0000864
OrthoInspector 1 1.000 T1061650
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R764
TreeFam 00.000 Not matched by this tool.
88.100

Return to query results.
Submit another query.