DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Mtr4 and skiv2l

Sequence 1:NP_524929.1 Gene:Mtr4 FlyBaseID:FBgn0001986 Length:1055 Species:Drosophila melanogaster
Sequence 2:XP_017952200.1 Gene:skiv2l XenbaseID:XB-GENE-486233 Length:1253 Species:Xenopus tropicalis

Alignment Length:1148 Identity:398/1149 (35%)
Similarity:594/1149 (52%) Gaps:169/1149 (15%)


  Fly     4 EELFDCFDEVTPSVPPPALNQEEKPSGSSASKKG-NKRQAD-----GT-TASKEATSSKGAEGDD 61
            ||:...|:....:|||             ..|.| |.:|:|     || |.|....:.:.....|
 Frog   176 EEVALDFNNDLLAVPP-------------GWKYGMNFKQSDILHPAGTLTLSSLLGTLEDFTFGD 227

  Fly    62 KGDVTEEPTKRLKQEASTVAVDDDNNADDEPTRTLDIDDSATLEALRTRIVTHLLDAP------- 119
            ..|..|...||             :.|..|.|:|..:..|.:||.|...:......:|       
 Frog   228 SSDDEEAGEKR-------------SGAGTERTKTEGLQRSNSLEELGLEVTEWTKSSPVLAPVLP 279

  Fly   120 -KSCTHEVAAHPDQEYIPLKPF-SGVP--AKEYPFVLDPFQRQAILCIDNSQSVLVSAHTSAGKT 180
             ....||..|.|.....|:..| ..:|  |.::||.|||||::||.|::...||.::||||||||
 Frog   280 EAEVPHEQWAVPLDSNSPVANFYKQIPDLAFKHPFELDPFQKKAIQCLEAGSSVFIAAHTSAGKT 344

  Fly   181 VVAEYAIAKSLAAKQRVIYTTPIKALSNQKFREFTDEFKDVGLVTGDVTINPSASCLIMTTEILR 245
            ||||||||.||....|.|||:|||||||||||:|...|.||||:||||.:...||||||||||||
 Frog   345 VVAEYAIALSLKHMTRAIYTSPIKALSNQKFRDFKITFGDVGLITGDVQLYTGASCLIMTTEILR 409

  Fly   246 NMLYRGSEIMREVGWVVFDEIHYMRDKERGVVWEETLILLPDNVRYVFLSATIPNARQFAEWVCH 310
            :|||.||:::|::.||:|||:||:.|.||||||||.||:|||:|..:.||||:||..:||:|:..
 Frog   410 SMLYNGSDVIRDLEWVIFDEVHYINDAERGVVWEEVLIMLPDHVNIILLSATVPNTVEFADWIGR 474

  Fly   311 LHKQPCHVVYTDYRPTPLQHYIFPAGG----DGIHLIVDEKGQFKEDNFTTAMAVLANAGEAGKG 371
            :.|:..:|:.|..||.||:||::....    :...|::|..|.|:...:..  ||.|....:.|.
 Frog   475 IKKKKIYVISTTRRPVPLEHYLYTGNSQKTQNQFFLLLDALGGFQTKGYYA--AVEAKKERSSKY 537

  Fly   372 DQ----KGRHGGIKGTNAGQTNIFKIVKMIMERNFAPVIIFSFSKKDCEIYAMQMAKLDFNTPDE 432
            .|    |..||...|.:.|  ....:|:.:..|:..||::|:||:..||..|..::.:|..:..|
 Frog   538 SQTFGAKHPHGVGPGHDKG--TWLSLVQSLKIRDALPVVVFTFSRTRCEQNATALSTVDLCSTAE 600

  Fly   433 KKLVDEVFNNAMDVLTEEDRRLPQVENVLPLLRRGIGIHHGGLLPILKETIEILFGEGLIKALFA 497
            |..|...:...:..|...||:||||.::|.||:|||||||.|:||||||.:|:||..||:|.|||
 Frog   601 KSEVQTYYTKCLSRLRGADRQLPQVLHMLDLLKRGIGIHHSGILPILKEVVEMLFSRGLVKILFA 665

  Fly   498 TETFAMGLNMPARTVLFTAPRKFDGKKFRWISSGEYIQMAGRAGRRGLDDKGIVILMIDEKVSPA 562
            |||||||:|||||||:|.:.||.||..||.::.||||||||||||||||:.|:||::....| |.
 Frog   666 TETFAMGVNMPARTVVFDSIRKHDGSNFRDLTPGEYIQMAGRAGRRGLDNTGMVIILCKADV-PE 729

  Fly   563 VG--RDIVQGKADPINSAFHLTYNMVLNLLRVEEINPEYMLERSFYQFQNQAALPGLHDQVEQKT 625
            :.  ..::.||...:.|.|.|||:|:|||||||.:..|.|::|||.:.:.|........:::..|
 Frog   730 MSDLHKMMLGKPTQLQSQFRLTYSMILNLLRVEALRVEDMMKRSFAESRTQRDSKAHEQRIKLLT 794

  Fly   626 LELNKL-TIKDEHNIASYH----------HIRSQLDQH-------------------GKQFRQWI 660
            .:|..: .|:...::|..|          :.|..:.:.                   ..::..|:
 Frog   795 QQLADVGDIECSGDLADLHDYFVTVQELIYTRETVQKRVVESINGMKCLSVGRIIIINTEYHSWV 859

  Fly   661 TKPQYLLPFLQPGRLVKVAAGSQEYDWGIVLNFKKQ-------DQSRKNPLKAEPSVTIDVLLHV 718
                       ||.:::|::.:....:..::.::|:       .::|:..:|..| |..|:|:  
 Frog   860 -----------PGVILQVSSDAANRIYTTLVLYEKRREIGVLHQETREKEVKKAP-VPEDLLM-- 910

  Fly   719 SEAAAKTGDTE-PCKPNERGCMEVVPVAHTLITQISSIRVYFPNDLR-SADNRRAVLKTIQEAK- 780
                .|....| ||.            ...|..:.|.|.:.....|| .||.   :|..|.::: 
 Frog   911 ----GKVFRPEGPCD------------YRLLKLRSSDINIVTGKTLRIHADK---ILDDIAKSQM 956

  Fly   781 ---KRFPLGPPV--------------------LNPIDDMNIKDREFRDIVNTISQFEKRLEEHPL 822
               :..|.||.:                    |.|::|:.:|:.|..:.|:...:.|:.|:....
 Frog   957 PRYRNDPPGPALSSVTQELARLADLPSGSLSSLCPVNDLQLKELELVEAVSRGKRLEEALQSFSC 1021

  Fly   823 HKSPELERIHRRYQDKVTLQKQLQDLKAELKAAR------SLLQMDELKHRKRVLRRMGYCKPGD 881
            :.||       |:..:..|.:|...:..||:..|      ||..:.|.:.|..|||.:.|...|.
 Frog  1022 YNSP-------RFNTQYILLEQRSQVLNELERLRFLTSDQSLSLLPEYQQRVNVLRTLQYIDDGG 1079

  Fly   882 VIEFKGRVACELSSADELLMTEMIFNGVFNDLTAPQAVALLSCFVCDEKSSESVKSATELSGPLR 946
            .::.|||||||:|| .|||:||::.:|..:.|...:..|||||.|...|:....:....|...::
 Frog  1080 AVQLKGRVACEVSS-HELLVTELVLDGALSPLAPEEIAALLSCLVFQHKTQCEPRLTDTLKQGVK 1143

  Fly   947 SMQDLARRIAKVSTECKLDLDADTYVDKFKPFLMDVVLAWCKGSSFLAVCKMTDIFEGSIIRCMR 1011
            .:::||.|:|.:..||.|....:.:|.::|..|.:||..|.:|..|..:..:|||.||.|:||::
 Frog  1144 KVRELAERLALIQRECGLRESVEDFVAQYKFGLTEVVYEWARGMPFSEIMTLTDIQEGLIVRCVQ 1208

  Fly  1012 RLEELLRQMCQASKTIGNTDLENKFSEGIRLLKRDIVFAASLY 1054
            ||:|..|.:..|::.:|:..|..|.....:|:||||:||||||
 Frog  1209 RLDEACRDVRSAARLVGDATLCAKMDAASQLIKRDIIFAASLY 1251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mtr4NP_524929.1 Dob10 91..1055 CDD:226947 377/1055 (36%)
DEAD 154..299 CDD:278688 95/145 (66%)
HELICc 390..554 CDD:238034 87/164 (53%)
rRNA_proc-arch 600..853 CDD:289976 53/316 (17%)
DSHCT 881..1048 CDD:285374 60/167 (36%)
skiv2lXP_017952200.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG4581
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D176060at2759
OrthoFinder 1 1.000 FOG0000864
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.