DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimC3 and SCARF2

Sequence 1:NP_524928.2 Gene:NimC3 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_699165.3 Gene:SCARF2 HGNCID:19869 Length:871 Species:Homo sapiens

Alignment Length:196 Identity:49/197 (25%)
Similarity:64/197 (32%) Gaps:55/197 (28%)


  Fly    45 AKTRMAGAGPPNASHPIDL---------DSYVVYEERVRWDNI------QV--CCPGYR----TI 88
            |:.|.|| |||:...|..|         |:....|...|..|:      ||  ||.|:|    ..
Human    12 ARRRGAG-GPPSPLLPSLLLLLLLWMLPDTVAPQELNPRGRNVCRAPGSQVPTCCAGWRQQGDEC 75

  Fly    89 LFGFCEPVCQEACPAHSYCAEPDRCHCQRGYEPSHHHTTGHQLICRPVCQGGCPEHSH------- 146
            ....||.  ...|..:..|..|..|.|:.||..::..|...:....|.|:..|..|.|       
Human    76 GIAVCEG--NSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQFWGPDCKELCSCHPHGQCEDVT 138

  Fly   147 --CVAH---------NECECWPGFKDASSWFSLSLRCE----------RVQCGHEQRFDPGRRAC 190
              |..|         :.|:|..|.....|.   :.|||          ...|....|.||...||
Human   139 GQCTCHARRWGARCEHACQCQHGTCHPRSG---ACRCEPGWWGAQCASACYCSATSRCDPQTGAC 200

  Fly   191 V 191
            :
Human   201 L 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 31/140 (22%)
SCARF2NP_699165.3 PHA03247 <534..871 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.