DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimC3 and MEGF11

Sequence 1:NP_524928.2 Gene:NimC3 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_016878159.1 Gene:MEGF11 HGNCID:29635 Length:1097 Species:Homo sapiens

Alignment Length:186 Identity:45/187 (24%)
Similarity:57/187 (30%) Gaps:75/187 (40%)


  Fly    58 SHPIDLDSYVVYEERVRWDNI----------------------QVCCPGYRTILFGFCEPVCQEA 100
            :||.|...|....:.:.|...                      ..|||||.. ...||.|:|.|.
Human    43 AHPFDQIYYTRCTDILNWFKCTRHRISYKTAYRRGLRTMYRRRSQCCPGYYE-SGDFCIPLCTEE 106

  Fly   101 CPAHSYCAEPDRCHCQRGYEPSHHHTTGHQLICRPVCQGGC-PEH--SHCVAHNECE-------- 154
            | .|..|..||.|||:.|:.             .|.|..|| .:|  .||....:|:        
Human   107 C-VHGRCVSPDTCHCEPGWG-------------GPDCSSGCDSDHWGPHCSNRCQCQNGALCNPI 157

  Fly   155 -----CWPGFKDASSWFSLSLRCERV--------------QCGHEQRFDPGRRACV 191
                 |..||:   .|     |||.:              ||.|....||....|:
Human   158 TGACVCAAGFR---GW-----RCEELCAPGTHGKGCQLPCQCRHGASCDPRAGECL 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 36/138 (26%)
MEGF11XP_016878159.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.