DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimC3 and Pear1

Sequence 1:NP_524928.2 Gene:NimC3 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001027585.1 Gene:Pear1 MGIID:1920432 Length:1034 Species:Mus musculus

Alignment Length:128 Identity:36/129 (28%)
Similarity:52/129 (40%) Gaps:35/129 (27%)


  Fly    75 WDNIQVCCPG---YRTILFGFCEPVCQEACPAHSYCAEPDRCHCQRGYEPSHHHTTGHQLICRPV 136
            |::...|...   |||:   :.:.|..::.|         |..|.|||..|..       .|.|:
Mouse    57 WEDPHTCAQPTVVYRTV---YRQVVKMDSRP---------RLQCCRGYYESRG-------ACVPL 102

  Fly   137 CQGGCPEHSHCVAHNECECWPGFK--DASS------WFSLSLRCER-VQCGHEQRFDPGRRAC 190
            |...| .|..|||.|:|:|.||::  |.||      |   ..:|:: ..||:....||....|
Mouse   103 CAQEC-VHGRCVAPNQCQCAPGWRGGDCSSECAPGMW---GPQCDKFCHCGNNSSCDPKSGTC 161

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 34/116 (29%)
Pear1NP_001027585.1 EMI 25..93 CDD:284877 12/48 (25%)
EGF_CA 535..580 CDD:304395
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.