DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment NimC3 and Megf10

DIOPT Version :9

Sequence 1:	NP_524928.2	Gene:	NimC3 / 48772	FlyBaseID:	FBgn0001967	Length:	224	Species:	Drosophila melanogaster
Sequence 2:	NP_001001979.1	Gene:	Megf10 / 70417	MGIID:	2685177	Length:	1147	Species:	Mus musculus

Alignment Length:	153	Identity:	33/153 - (21%)
Similarity:	51/153 - (33%)	Gaps:	54/153 - (35%)

- Green bases have known domain annotations that are detailed below.

  Fly    59 HPIDLDSYVVYEERVRWDNIQVCCPGY---RTILFGFCEPVCQEACPAHSYCAEPDRCHCQRGYE 120
            |.|...:...:.|:..:.....||||:   |.:    |.|.|.:.| .|..|..|:.|.|:.|:.
Mouse    72 HRISYRTAYRHGEKTMYRRKSQCCPGFYESRDM----CVPHCADKC-VHGRCIAPNTCQCEPGWG 131

  Fly   121 PSH-------HHTTGH---------QLICRPV--------------CQGGCPE-------HSHCV 148
            .::       .|...|         :.:|.|:              |:..|.:       |..|.
Mouse   132 GTNCSSACDGDHWGPHCSSRCQCKNRALCNPITGACHCAAGYRGWRCEDRCEQGTYGNDCHQRCQ 196

  Fly   149 AHN---------ECECWPGFKDA 162
            ..|         ||.|.||:..|
Mouse   197 CQNGATCDHITGECRCSPGYTGA 219

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
NimC3	NP_524928.2	MSC	85..>212	CDD:286487	26/127 (20%)
Megf10	NP_001001979.1	Necessary for interaction with AP2M1, self-assembly and formation of the irregular, mosaic-like adhesion pattern. /evidence=ECO:0000250\|UniProtKB:Q96KG7	1..857		33/153 (22%)
		EMI	32..99	CDD:284877	7/26 (27%)
		EGF_CA	281..326	CDD:304395
		EGF_CA	542..587	CDD:304395
		Necessary for formation of large intracellular vacuoles. /evidence=ECO:0000250\|UniProtKB:Q96KG7	945..1147
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1093..1147
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1218
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900