| Sequence 1: | NP_524928.2 | Gene: | NimC3 / 48772 | FlyBaseID: | FBgn0001967 | Length: | 224 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001001979.1 | Gene: | Megf10 / 70417 | MGIID: | 2685177 | Length: | 1147 | Species: | Mus musculus |
| Alignment Length: | 153 | Identity: | 33/153 - (21%) |
|---|---|---|---|
| Similarity: | 51/153 - (33%) | Gaps: | 54/153 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 59 HPIDLDSYVVYEERVRWDNIQVCCPGY---RTILFGFCEPVCQEACPAHSYCAEPDRCHCQRGYE 120
Fly 121 PSH-------HHTTGH---------QLICRPV--------------CQGGCPE-------HSHCV 148
Fly 149 AHN---------ECECWPGFKDA 162 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| NimC3 | NP_524928.2 | None | |||
| Megf10 | NP_001001979.1 | Necessary for interaction with AP2M1, self-assembly and formation of the irregular, mosaic-like adhesion pattern. /evidence=ECO:0000250|UniProtKB:Q96KG7 | 1..857 | 33/153 (22%) | |
| EMI | 31..100 | CDD:462204 | 7/27 (26%) | ||
| EGF_Lam | 281..318 | CDD:214543 | |||
| EGF_CA | 542..587 | CDD:473889 | |||
| Necessary for formation of large intracellular vacuoles. /evidence=ECO:0000250|UniProtKB:Q96KG7 | 945..1147 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1093..1147 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||