DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimC3 and Megf10

Sequence 1:NP_524928.2 Gene:NimC3 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001001979.1 Gene:Megf10 MGIID:2685177 Length:1147 Species:Mus musculus

Alignment Length:153 Identity:33/154 (21%)
Similarity:51/154 (33%) Gaps:54/154 (35%)


  Fly    59 HPIDLDSYVVYEERVRWDNIQVCCPGY---RTILFGFCEPVCQEACPAHSYCAEPDRCHCQRGYE 120
            |.|...:...:.|:..:.....||||:   |.:    |.|.|.:.| .|..|..|:.|.|:.|:.
Mouse    72 HRISYRTAYRHGEKTMYRRKSQCCPGFYESRDM----CVPHCADKC-VHGRCIAPNTCQCEPGWG 131

  Fly   121 PSH-------HHTTGH---------QLICRPV--------------CQGGCPE-------HSHCV 148
            .::       .|...|         :.:|.|:              |:..|.:       |..|.
Mouse   132 GTNCSSACDGDHWGPHCSSRCQCKNRALCNPITGACHCAAGYRGWRCEDRCEQGTYGNDCHQRCQ 196

  Fly   149 AHN---------ECECWPGFKDA 162
            ..|         ||.|.||:..|
Mouse   197 CQNGATCDHITGECRCSPGYTGA 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 26/128 (20%)
Megf10NP_001001979.1 Necessary for interaction with AP2M1, self-assembly and formation of the irregular, mosaic-like adhesion pattern. {ECO:0000250|UniProtKB:Q96KG7} 1..857 33/154 (21%)
EMI 32..99 CDD:284877 7/27 (26%)
EGF_CA 281..326 CDD:304395
EGF_CA 542..587 CDD:304395
Necessary for formation of large intracellular vacuoles. {ECO:0000250|UniProtKB:Q96KG7} 945..1147
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.