DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and Megf11

DIOPT Version :10

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_038938374.1 Gene:Megf11 / 691517 RGDID:1582797 Length:1139 Species:Rattus norvegicus


Alignment Length:186 Identity:47/186 - (25%)
Similarity:57/186 - (30%) Gaps:75/186 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SHPIDLDSYVVYEERVRWDNI----------------------QVCCPGYRTILFGFCEPVCQEA 100
            :||.|...|....:.:.|...                      ..|||||.. ...||.|:|.|.
  Rat    43 AHPFDQIYYTRCADILNWFKCTRHRISYKTAYRRGLRTMYRRRSQCCPGYYE-NGDFCIPLCTEE 106

  Fly   101 CPAHSYCAEPDRCHCQRGYEPSHHHTTGHQLICRPVCQGGC-PEH--SHCVAHNECE-------- 154
            | .|..|..||.|||:.|:.             .|.|..|| .||  .||....:|:        
  Rat   107 C-MHGRCVSPDTCHCEPGWG-------------GPDCSSGCDSEHWGPHCSNRCQCQNGALCNPI 157

  Fly   155 -----CWPGFKDASSWFSLSLRCER--------------VQCGHEQRFDPGRRACV 191
                 |.|||:   .|     |||.              .||.|....||....|:
  Rat   158 TGACVCAPGFR---GW-----RCEEFCAPGTHGKGCQLLCQCHHGASCDPRTGECL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 None
Megf11XP_038938374.1 EMI 25..94 CDD:462204 10/50 (20%)
EGF_CA 189..234 CDD:473889 6/17 (35%)
Laminin_EGF 275..320 CDD:395007
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.