DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimC3 and pear1

Sequence 1:NP_524928.2 Gene:NimC3 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_700533.4 Gene:pear1 ZFINID:ZDB-GENE-091230-1 Length:1020 Species:Danio rerio

Alignment Length:129 Identity:36/130 (28%)
Similarity:48/130 (37%) Gaps:27/130 (21%)


  Fly    68 VYEERVRWD--NIQVCCPGYRTILFGFCEPVCQEACPAHSYCAEPDRCHCQRGYE--------PS 122
            :|.:.|:.|  ....||||:.... ..|.|.|.:.| .|..|..||||.|:.|:.        ..
Zfish    76 LYRQVVKMDYRRRYQCCPGFYESR-NKCVPRCTKEC-VHGRCVAPDRCQCEMGWRGDDCSSSCDG 138

  Fly   123 HHHTTGHQLICRPVCQGGCPEHSHC-VAHNECECWPGFKDAS-------SWFSLSLRCERVQCG 178
            .|...|    ||.:|:  |.....| |....|:|..|:....       .||....| :..|||
Zfish   139 QHWGPG----CRRLCE--CQNGGECDVLTGNCQCPAGYTGQHCHDPCPVKWFGQGCR-QECQCG 195

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 29/111 (26%)
pear1XP_700533.4 EMI 29..96 CDD:284877 7/20 (35%)
Laminin_EGF 411..451 CDD:278482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.