DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and Dkk2

DIOPT Version :9

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_006501881.1 Gene:Dkk2 / 56811 MGIID:1890663 Length:272 Species:Mus musculus


Alignment Length:151 Identity:35/151 - (23%)
Similarity:50/151 - (33%) Gaps:61/151 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 VCCPGYRTILFGFCEPVCQEA----CPAHSYCAEPDRCHCQRGYEPSHH--------------HT 126
            :||||.| ...|.|.||.:..    .||.......||.|   |:..:|.              |.
Mouse   128 MCCPGTR-CNNGICIPVTESILTPHIPALDGTRHRDRNH---GHYSNHDLGWQNLGRPHSKMPHI 188

  Fly   127 TGHQ----------------------LICRPVCQGG--CPEHSHCVAH-----NECECWPG---- 158
            .||:                      .||:||...|  |.:.....:|     ..|:|..|    
Mouse   189 KGHEGDPCLRSSDCIDGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCK 253

  Fly   159 -FKDASSWFSLSLR---CERV 175
             :|||:  :|...|   |:::
Mouse   254 VWKDAT--YSSKARLHVCQKI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 31/146 (21%)
Dkk2XP_006501881.1 Dickkopf_N 91..141 CDD:368068 6/13 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.