DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimC3 and zgc:158328

Sequence 1:NP_524928.2 Gene:NimC3 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001073658.1 Gene:zgc:158328 ZFINID:ZDB-GENE-070112-1202 Length:1339 Species:Danio rerio

Alignment Length:211 Identity:48/212 (23%)
Similarity:71/212 (33%) Gaps:82/212 (39%)


  Fly    25 LAITNGHCQKNISVKYQVPVAKTRMAGAGPPNASHPIDLDSYVVYEERVRWDNIQVC--CPGYRT 87
            |..|..||:| :.|                 :..:.::.:...|.:.....|....|  ||.   
Zfish  1138 LGWTGQHCEK-VCV-----------------SGHYGVNCEQKCVCQNNGTCDRFTGCCSCPS--- 1181

  Fly    88 ILFGFCEPVCQEACPAHSY---CAEPDRCHCQRGYE-----------PSHHHTTGHQLICRPVCQ 138
               |:..|.||..|||..:   ||:|  |.|::|::           |.:|   |:|  |...|:
Zfish  1182 ---GYYGPACQHRCPAGFFGELCAQP--CVCKQGHQCDHVTGKCECPPGYH---GNQ--CEKRCE 1236

  Fly   139 GG-----------CPEHSHCVAHNECECWPGFKDASSWFSLSLRCERV--------------QCG 178
            .|           |...|......:|.|.||        ....|||:|              :|.
Zfish  1237 SGRFGRDCAGVCDCDGASCDPTTGQCLCPPG--------KTGERCEKVCDSRYYGPDCSFQCECV 1293

  Fly   179 HEQRFDP--GRRACVQ 192
            |..:.||  |..:|.|
Zfish  1294 HGGQCDPQTGHCSCPQ 1309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 37/150 (25%)
zgc:158328NP_001073658.1 EMI 15..83 CDD:284877
FXa_inhibition 134..169 CDD:291342
vWFA <159..209 CDD:294047
FXa_inhibition 258..293 CDD:291342
vWFA <293..332 CDD:294047
FXa_inhibition 345..380 CDD:291342
vWFA <372..413 CDD:294047
vWFA <419..459 CDD:294047
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.