DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and ccbe1

DIOPT Version :10

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001157395.1 Gene:ccbe1 / 555629 ZFINID:ZDB-GENE-090506-7 Length:401 Species:Danio rerio


Alignment Length:176 Identity:34/176 - (19%)
Similarity:58/176 - (32%) Gaps:52/176 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 CCPGYRTILFGFCEPVCQEAC---PAHSYCAEPDR---CHCQRGYE-PSHHHTTGHQLICRPVCQ 138
            ||.|::.:| |.|.|...:.|   |....|.:...   |.|..||. ....|....:..|..:.:
Zfish    66 CCEGFKFVL-GQCIPEDYDVCAGAPCEQQCTDHFGRVVCTCYDGYRYDRERHRNREKPYCLDIDE 129

  Fly   139 GGCPEHSHCVAHNECECWPGFKDASSWFSLSLRCERVQCGHEQRFDPGRRACV------------ 191
              |..::..|....|...||          |.||:   |......:...:.|.            
Zfish   130 --CANNNETVCSQMCVNTPG----------SYRCD---CHSGFYLEDDGKTCTKGERAPLFEKSD 179

  Fly   192 ----------------QIEMSMEELMQRVAERLAKGLEAEEEAANE 221
                            |::|::.:|.|::: .|:...|..::..||
Zfish   180 NVMKEGTCSATCEDFHQMKMTVLQLKQKMS-LLSSNTEINKQMTNE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 None
ccbe1NP_001157395.1 FXa_inhibition 130..166 CDD:464251 9/48 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..321
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..401
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.