DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and NimB3

DIOPT Version :9

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001033905.1 Gene:NimB3 / 3885611 FlyBaseID:FBgn0054003 Length:122 Species:Drosophila melanogaster


Alignment Length:115 Identity:28/115 - (24%)
Similarity:42/115 - (36%) Gaps:43/115 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NGHCQKNISVKYQVPVAKTRMAGAGPPNASHPIDLDSYVVYEERVRWDNIQVCCPGYRTILFGF- 92
            :|.|.:.::|:...|.::.|..              ||              ||.||  :..|. 
  Fly    46 SGICYRTLTVETINPNSRNRQF--------------SY--------------CCDGY--VNKGTS 80

  Fly    93 ----CEPVCQEACPAHSYCAEPDRCHCQRGYEPSHHHTTGHQLICRPVCQ 138
                |||:|.|.| ::..|..|:.|.|..||..|:..       ||.|.:
  Fly    81 QNLKCEPICSEDC-SNGLCLAPEECECAPGYYRSNKR-------CRFVLE 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 18/59 (31%)
NimB3NP_001033905.1 PLN03223 <49..>106 CDD:215637 20/87 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.