DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimC3 and NimB3

DIOPT Version :10

Sequence 1:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001033905.1 Gene:NimB3 / 3885611 FlyBaseID:FBgn0054003 Length:122 Species:Drosophila melanogaster


Alignment Length:115 Identity:28/115 - (24%)
Similarity:42/115 - (36%) Gaps:43/115 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NGHCQKNISVKYQVPVAKTRMAGAGPPNASHPIDLDSYVVYEERVRWDNIQVCCPGYRTILFGF- 92
            :|.|.:.::|:...|.::.|..              ||              ||.||  :..|. 
  Fly    46 SGICYRTLTVETINPNSRNRQF--------------SY--------------CCDGY--VNKGTS 80

  Fly    93 ----CEPVCQEACPAHSYCAEPDRCHCQRGYEPSHHHTTGHQLICRPVCQ 138
                |||:|.|.| ::..|..|:.|.|..||..|:..       ||.|.:
  Fly    81 QNLKCEPICSEDC-SNGLCLAPEECECAPGYYRSNKR-------CRFVLE 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 None
NimB3NP_001033905.1 PLN03223 <49..>106 CDD:215637 20/87 (23%)

Return to query results.
Submit another query.