DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimC3 and drpr

Sequence 1:NP_524928.2 Gene:NimC3 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster

Alignment Length:265 Identity:59/266 (22%)
Similarity:84/266 (32%) Gaps:92/266 (35%)


  Fly     1 MLQQVLYPMLV-LVLMTIHLVEVSSLAITNGHCQKNISVKYQVPVAKTRMAG----------AGP 54
            ||..:|...|. |||....|.::....|    |::.  ..|.|.|..|.:..          ..|
  Fly     1 MLPVILIACLAQLVLAQADLKDLDGPNI----CKRR--ELYNVDVVYTELQSFQERGSTWCVTFP 59

  Fly    55 PNAS-----HPIDLDSYVVYEERVRWDNIQVCCPGYRTILFGFCEPVCQEACPAHSYCAEPDRCH 114
            |..|     |.:...:..:.:.|:    ::.||.|| ....|.|.|.|.|.| .|..|..|::|.
  Fly    60 PRCSTYRIKHRVVNKTKTIAKNRI----VRDCCDGY-IASAGECVPHCSEPC-QHGRCISPEKCK 118

  Fly   115 CQRGY------------------------------EPSHHHT------TGHQLICRPVCQGG--- 140
            |..||                              ||.....      ||.:  |..:|..|   
  Fly   119 CDHGYGGPACDINCPPGWYGRNCSMQCDCLNNAVCEPFSGDCECAKGYTGAR--CADICPEGFFG 181

  Fly   141 --CPEHSHC----VAHN---ECECWPGFKDASSWFSLSLRC----------ERVQCGHEQRFDPG 186
              |.|...|    ..|:   ||:|.|||...    ...:||          :...|.::.:..|.
  Fly   182 ANCSEKCRCENGGKCHHVSGECQCAPGFTGP----LCDMRCPDGKHGAQCQQDCPCQNDGKCQPE 242

  Fly   187 RRACV 191
            ..||:
  Fly   243 TGACM 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 37/166 (22%)
drprNP_001261276.1 EMI 27..92 CDD:284877 15/76 (20%)
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.