DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimC3 and NimC2

Sequence 1:NP_524928.2 Gene:NimC3 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001285922.1 Gene:NimC2 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster

Alignment Length:146 Identity:45/147 (31%)
Similarity:61/147 (41%) Gaps:43/147 (29%)


  Fly    81 CCPGYR---TILFGFCEPVCQEACPAHSYCAEPDRCHCQRGY---------EP--------SH-- 123
            |..|||   ::....|||:|.:.| .|.:|..|:.|.|..|:         ||        ||  
  Fly   409 CFTGYRPNPSLGANVCEPICSQGC-VHGFCIAPEICQCDLGFIKRWATGTCEPHCPQKCVNSHCL 472

  Fly   124 -----HHTTGHQL------ICRPVCQGGCPEHSHCVAHNECECWPGFKDASSWF----SLSLRCE 173
                 ....|::|      ||.|.||.|| .:..||..|.|.|:.|::|....:    |...|||
  Fly   473 GSGVCRCYEGYKLRPGSTSICDPECQPGC-RNGTCVEPNSCACFAGYEDTKVPYECVPSCRPRCE 536

  Fly   174 RVQC---GHEQRFDPG 186
            ..:|   ||.: .|||
  Fly   537 NGRCSSPGHCE-CDPG 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 43/143 (30%)
NimC2NP_001285922.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24047
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.