DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimC3 and NimB4

Sequence 1:NP_524928.2 Gene:NimC3 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_788046.1 Gene:NimB4 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster

Alignment Length:137 Identity:39/138 (28%)
Similarity:55/138 (40%) Gaps:30/138 (22%)


  Fly    82 CPGYRTILFG---------------FCEPVCQEACPAHSYCAEPDRCHCQRGYEPSHHHTTGHQL 131
            ||..|..|.|               ||:|.|...|..:..|.||.:|.|..||......:..  |
  Fly   181 CPHGRCYLNGTCQCDKGYELDGSRKFCQPQCNATCGHNEVCLEPGKCSCAEGYTRGLRESAA--L 243

  Fly   132 ICRPVCQGGCPEHSHCVAHNECECWPGFKDASSWFSLS----LRCERVQCGHE--------QRFD 184
            .|:|:|...| .:.|||..|||||:|||:...:..:..    :.||...|.::        .|:|
  Fly   244 GCQPICIPDC-GYGHCVRPNECECFPGFQKRKNGITCEGDCYMTCENGFCANKTTCVCQNGYRYD 307

  Fly   185 PGRRACV 191
            .....|:
  Fly   308 KNTTTCL 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NimC3NP_524928.2 MSC 85..>212 CDD:286487 37/135 (27%)
NimB4NP_788046.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24047
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.